Loading...
08 - Appendix F Phase I ESA & Phase II LSID RAFT E NVIRONMENTAL I MPACT R EPORT F EBRUARY 2020 C YPRESS C ITY C ENTER P ROJECT C YPRESS, C ALIFORNIA P:\CCP1902\Screencheck Draft EIR\Appendices\Appendix F Cover.docx (02/03/20) APPENDIX F PHASE I ENVIRONMENTAL SITE ASSESSMENT AND PHASE II LIMITED SOIL INVESTIGATION C YPRESS C ITY C ENTER P ROJECT C YPRESS, C ALIFORNIA D RAFT E NVIRONMENTAL I MPACT R EPORT F EBRUARY 2020 P:\CCP1902\Screencheck Draft EIR\Appendices\Appendix F Cover.docx (02/03/20) This page intentionally left blank 2217.0014L.100/R Environmental Consulting & Management +1.800.322.ROUX rouxinc.com Phase I Environmental Site Assessment and Phase II Limited Soil Investigation ________________________________ Northwest Corner of Katella Avenue and Winners Circle Cypress, California June 26, 2019 Prepared for: Shea Properties Prepared by: Roux Associates, Inc. 5150 East Pacific Coast Highway, Suite 450 Long Beach, California 90804 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | i Table of Contents 1. Introduction ............................................................................................................................................... 1 1.1 Purpose ..................................................................................................................................... 1 1.2 Scope of Services ...................................................................................................................... 1 1.3 Phase I ESA Standard of Care .................................................................................................. 2 1.4 Phase I ESA Assumptions ......................................................................................................... 3 1.5 Phase I ESA Limitations and Exceptions .................................................................................. 4 1.6 Phase I ESA Special Terms and Conditions ............................................................................. 4 1.7 User Reliance ............................................................................................................................ 5 Site Description ................................................................................................................................ 6 2.1 Location and Legal Description ................................................................................................. 6 2.2 Site and Vicinity General Characteristics .................................................................................. 6 2.3 Description of Structures, Roads, and Other Site Improvements ............................................. 6 2.4 Current and Past Use of the Site ............................................................................................... 6 2.5 Current Uses of the Adjoining Properties .................................................................................. 6 2.6 Physical Setting ......................................................................................................................... 6 2.6.1 Surface Water and Drainage .............................................................................................. 7 2.6.2 Physiographic Setting ......................................................................................................... 7 2.6.3 Regional and Local Geology ............................................................................................... 7 2.6.4 Regional and Local Hydrogeology ...................................................................................... 7 User-Provided Information ............................................................................................................... 8 3.1 Environmental Liens or Activity and Use Limitations................................................................. 8 3.2 Specialized Knowledge ............................................................................................................. 8 3.3 Valuation Reduction for Environmental Issues .......................................................................... 8 3.4 Commonly Known or Reasonably Ascertainable Information ................................................... 8 3.5 Obvious Indicators of the Presence or Likely Presence of Contamination of the Site .............. 8 3.6 Previous Phase I ESA Report ................................................................................................... 8 Records Review ............................................................................................................................. 10 4.1 Historical Sources Summary ................................................................................................... 10 4.2 Database Search ..................................................................................................................... 15 4.3 Information from Government Agencies .................................................................................. 21 4.3.1 Federal Agencies .............................................................................................................. 22 4.3.2 State Agencies .................................................................................................................. 22 4.3.3 County/Regional Agencies ................................................................................................ 23 4.3.4 City/Local Agencies........................................................................................................... 24 Site Reconnaissance ..................................................................................................................... 25 5.1 Methodology and Limiting Conditions ..................................................................................... 25 5.2 Interior and Exterior Observations ........................................................................................... 25 5.2.1 Drainage Swales or Culverts ............................................................................................ 26 5.2.2 Drains, Sumps, Wells, or Subsurface Piping .................................................................... 26 5.2.3 Equipment Suspected to Contain Polychlorinated Biphenyls ........................................... 26 5.2.4 Pools of Liquid ................................................................................................................... 26 5.2.5 Solid Waste ....................................................................................................................... 26 5.2.6 Stained Pavement ............................................................................................................. 26 Table of Contents (Continued) 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | ii 5.2.7 Other Features .................................................................................................................. 26 5.2.8 Vapor Intrusion .................................................................................................................. 27 Findings .......................................................................................................................................... 28 6.1 Data Gaps ................................................................................................................................ 28 6.2 Recognized Environmental Conditions ................................................................................... 28 6.3 Controlled Recognized Environmental Conditions .................................................................. 28 6.4 Historical Recognized Environmental Conditions.................................................................... 28 Phase II Limited Soil Investigation ................................................................................................. 29 7.1 Methods of Investigation .......................................................................................................... 29 7.1.1 Pre-Field Activities ............................................................................................................ 29 7.1.2 Soil Sampling Methodology and Sample Collection ......................................................... 29 7.1.3 Laboratory Analyses ......................................................................................................... 30 7.2 Results ..................................................................................................................................... 30 7.3 Conclusions and Recommendations ....................................................................................... 31 Deviations ...................................................................................................................................... 32 References ..................................................................................................................................... 33 Signature of Environmental Professional ....................................................................................... 34 Figures 1.Site Location Map 2.Site Plan 3.Soil Boring Locations Tables 1.Soil Analytical Results Appendices A.User-Provided Information B.Glossary of Terms C.Historical Topographic Maps D.EDR Radius Map Report with GeoCheck® E.Previous Phase I ESA F.Historical Aerial Photographs G.City Directories H.Sanborn Fire Maps I.Regulatory Records Documentation Table of Contents (Continued) 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | iii J. Photographic Log K. Laboratory Report L. Personnel Qualifications 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | ES Executive Summary Shea Properties (the User) retained Roux Associates, Inc. (Roux Associates) to perform a Phase I Environmental Site Assessment (ESA) and Phase II Limited Soil Investigation of a property located at the northwest corner of Katella Avenue and Winners Circle in Cypress, California, with the Assessor’s Parcel Numbers (APNs) 241-091-22, 23, 24, 25, and 26 (Site). As specified in our Proposal dated May 8, 2019, Roux Associates performed this Phase I ESA in general accordance with the American Society for Testing Materials (ASTM) Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process (ASTM E1527-13) in an effort to identify, to the extent feasible, the presence of recognized environmental conditions (RECs) with respect to the Site as defined in ASTM E1527-13. Exceptions to, or deviations from, this practice are described in Sections 1.5 and 8.0 of this report. The Site is a relatively flat vacant lot, approximately 13.29 acres in size, with no physical street address. The Site has historically been used for surface parking and staging of empty truck trailers and is bordered by an entrance to the Los Alamitos Race Course to the west, beyond which is a retail development; parking for the Los Alamitos Race Course (Race Course) to the north; Winners Circle the east, beyond which is Costco and other retail development; and, Katella Avenue to the south, beyond which are commercial properties. On May 13, 2019 Roux Associates representatives Messrs. Mauricio Escobar and Mark Edwards visually assessed the Site for potential RECs, including, but not limited to, potential underground storage tanks, aboveground storage tanks, polychlorinated biphenyl-containing equipment, hazardous materials storage or handling areas, containerized or bulk wastes, and visual indications of impacted soil. Roux Associates was unaccompanied during the Site reconnaissance. Roux Associates also performed a records review for the Site and surrounding properties in an effort to identify potential RECs in connection with the Site and assess potential concerns associated with the migration of hazardous substances to the Site from off-Site sources. The records review included reasonably ascertainable historical data, which can be helpful in identifying the past uses of the Site and surrounding areas, as it may relate to the environmental condition of the Site. ASTM E1527-13 defines a REC as: “The presence or likely presence of any hazardous substances or petroleum products in, on, or at a property: (1) due to release to the environment; (2) under conditions indicative of a release to the environment; or (3) under conditions that pose a material threat of a future release to the environment. De minimis conditions are not recognized environmental conditions.” A Controlled Recognized Environmental Condition (CREC) as: “A recognized environmental condition resulting from a past release of hazardous substances or petroleum products that has been addressed to the satisfaction of the applicable regulatory authority (for example, as evidenced by the issuance of a no further action letter or equivalent, or meeting risk- based criteria established by regulatory authority), with hazardous substances or petroleum products allowed to remain in place subject to the implementation of required controls (for example, property use restrictions, activity and use limitations, institutional controls, or engineering controls).” 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | ES And a Historical Recognized Environmental Condition (HREC) as: “A past release of any hazardous substances or petroleum products that has occurred in connection with the property and has been addressed to the satisfaction of the applicable regulatory authority or meeting unrestricted use criteria established by a regulatory authority, without subjecting the property to any required controls (for example, property use restrictions, activity and use limitations, institutional controls, or engineering controls). Before calling the past release a historical recognized environmental condition, the environmental professional must determine whether the past release is a recognized environmental condition at the time the Phase I Environmental Site Assessment is conducted (for example, if there has been a change in the regulatory criteria). If the EP considers the past release to be a recognized environmental condition at the time the Phase I ESA is conducted, the condition shall be included in the conclusions section of the report as a recognized environmental condition.” The term recognized environmental condition is not intended to include de minimis conditions that generally do not present a threat to human health or the environment and that generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies. This Executive Summary provides a brief overview of the findings of this Phase I ESA and Phase II Limited Soil Investigation. Although the Executive Summary is an integral part of a report, it does not substitute for reading the entire report or the appended or referenced documents in order to fully understand the findings and potential environmental concerns associated with the Site. Based upon the results of the Phase I ESA investigation described in this report, Roux Associates identified the following REC in connection with the Site. • REC-1: Disturbed/Imported Soils. Areas of historically disturbed and/or imported soils were identified along the southern and eastern boundaries of the Site. Aerial photographs from 1977 to 1990 suggest that two roughly square areas surrounded by earthen berms were being used to collect surface run-off from the Site and a portion of the Race Course to the north. Also, during the Site reconnaissance an approximately 5-foot high berm was observed along the length of the southern boundary, immediately adjacent to Katella Avenue; it is apparent from aerial photographs this was a feature that was emplaced in the mid-1990s. Additionally, near the southeastern corner of the Site, on-Site topography is several feet higher than the surroundings. Finally, aerial photographs show a construction staging area at the northeastern portion of the Site in the mid-2000s, which was confirmed by Mr. Frank Sherren who works for the Race Course and is knowledgeable of historical Site activities. During the Site reconnaissance it was noted that this northeastern area of the Site is missing surface pavement and coarse gravels resembling road base appeared to have been brought to the Site. Evidence of disturbed and possibly imported materials is considered a REC for the Site. Based upon the investigations described in this report, this Phase I ESA did not reveal evidence of HRECs in connection with the Site. Based upon the investigations described in this report, this Phase I ESA did not reveal evidence of CRECs in connection with the Site. On June 7, 2019, Roux Associates performed a Phase II Limited Soil Investigation at the Site to address disturbed and possibly imported materials along the southern and eastern portions of the Site. Shallow soil samples from approximately 0.5 and 1.5 feet below ground surface (bgs) were collected from eight locations 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | ES using hand tools. Initially all of the samples collected from 0.5 feet bgs were submitted for laboratory analysis of California Title 22 metals. In addition, one randomly selected sample collected from 0.5 feet bgs was also analyzed for Total Petroleum Hydrocarbons (TPH) and Volatile Organic Compounds (VOCs). Laboratory reports showed that Title 22 metals concentrations for all samples analyzed were within acceptable background ranges. Additional analyses showed TPH concentrations below actionable levels and VOC concentrations below laboratory method reported limits (MRLs) for all constituents in the one sample analyzed. Based on the results of the Phase II Limited Soil Investigation, REC-1 has been addressed and Roux Associates does not recommend any additional investigation at the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 1 1. Introduction Roux Associates, Inc. (Roux Associates) completed this Phase I Environmental Site Assessment (ESA) and Phase II Limited Soil Investigation of an approximately 13.29-acre property with Assessor’s Parcel Numbers (APNs) 241-091-22, 23, 24, 25, and 26, located at the northwest corner of Katella Avenue and Winners Circle in Cypress, California (Site; Figures 1 and 2). Roux Associates has performed the Phase I ESA in compliance with the scope and limitations of American Society for Testing Materials (ASTM) Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process (ASTM E1527-13). Both the Phase I ESA and the Phase II Limited Soil Investigation were performed in accordance with the scopes of work and the terms and conditions of Roux Associates’ proposals dated May 8, 2019 and May 30, 2019, respectively. Roux Associates conducted all of the work documented in this report for the benefit of Shea Properties (the User). Shea Properties is in the process of evaluating potential purchase and redevelopment of the Site as a mixed-use commercial and residential property, as presented in plans provided in Appendix A. Sections 3 through 6 of this report present our Phase I ESA findings and conclusions. Section 7 presents the protocols and procedures for the Phase II Limited Soil Investigation, as well as the sampling rationale, the laboratory results, and the conclusions and recommendations of the investigation. A glossary containing terms and definitions presented in ASTM E1527-13 is included as Appendix B – Glossary of Terms. Other appendices presented at the end of the report consist of figures, a table presenting soil analytical results, User-provided information, historical records, regulatory records review documentation, personnel qualifications, and laboratory data. 1.1 Purpose The purpose of this Phase I ESA is to identify and report, to the extent feasible, recognized environmental conditions (RECs) with respect to the Site. Performing a Phase I ESA in general compliance with ASTM E1527-13 may enable a User to satisfy one of the requirements to qualify for the innocent landowner, contiguous property owner, or bona fide prospective purchaser limitations on Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) liability. That is, the practice that constitutes one of the requirements for “all appropriate inquiry into the previous ownership and uses of the property consistent with good commercial or customary practice” as defined in 42 USC Section 9601(35) (B). The purpose of the Phase II Limited Soil Investigation was to address REC-1 by collecting shallow soil samples from the southern and eastern portions of the Site and conducting laboratory analysis to evaluate concentrations of Title 22 Metals, Total Petroleum Hydrocarbons (TPH) and volatile organic compounds (VOCs). The Phase II Limited Soil Investigation was intended to provide opinions and recommendations as to additional work that could be necessary for the Site (with respect to REC-1), if any. 1.2 Scope of Services The scope of services for the Phase I ESA included, but was not limited to, the activities listed below: • A review of reasonably ascertainable and practicably reviewable topographic maps, historical aerial photographs, and city directories to investigate past Site conditions; • A review of specific government lists pursuant to ASTM Standard E1527-13 regarding environmental activities for the Site and local area properties; 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 2 • A review of records, permits, citations, and/or reports connected to the Site that were reasonably ascertainable, practicably reviewable, and publicly available within reasonable time and cost; • An inspection by an environmental professional to investigate the current use of the Site and to identify environmental concerns including but not limited to, the presence of hazardous substances or petroleum products, wastes, underground storage tanks (USTs), aboveground storage tanks (ASTs), or other environmental concerns; and • Preparation of this Phase I ESA Report. Roux Associates initiated this Phase I ESA pursuant to written authorization received from the User on May 8, 2019. The scope of services for the Phase II Limited Soil Investigation included, but was not limited to, the activities listed below: • Pre-field activities including the preparation of a Site-specific Health & Safety Plan (HASP) and the notification of Underground Service Alert (USA) of intended subsurface work; • Collection of subsurface soil samples from eight (8) locations across the Site followed by laboratory analysis of the samples; and, • Preparation of this Phase II Limited Soil Investigation Report. Roux Associates initiated the Phase II Limited Soil Investigation pursuant to written authorization received from the User on June 2, 2019. 1.3 Phase I ESA Standard of Care Roux Associates conducted the Phase I ESA using a defined scope of services considered appropriate and agreed upon by all parties on the date the service was authorized, unless the scope of services or the methods used were later modified, in writing, and accepted by all parties prior to performance. Roux Associates conducted this Phase I ESA in accordance with generally accepted practices in a manner consistent with that level of care exercised by other members of our profession in the same locality and under similar conditions of time and accessibility of improvements and information. No other representations, expressed or implied, and no warranty or guarantee is included or intended to be part of this Phase I ESA. Please note that the scope of services performed in execution of this assessment may not be appropriate to satisfy the needs of other parties. We, therefore, are not responsible for independent conclusions, opinions, or recommendations of others based on our assessment. Furthermore, this Phase I ESA relates to the environmental conditions of the Site and does not address issues raised in transactions such as business risk, purchase of business entities, or interests therein, or of their assets, that may well involve environmental liabilities pertaining to properties previously owned or operated or other off-site liabilities. Additionally, the findings of this Phase I ESA are based on Roux Associates’ observations, inquiries, and historical research using reasonably ascertainable and practically reviewable information obtained within reasonable time and cost constraints. Roux Associates does not represent that this Phase I ESA is an exhaustive investigation that reflects the findings of all of the information available for the Site, nor is it 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 3 representative of future Site conditions. If additional information is generated from the Site, it should be provided to Roux Associates so that we may evaluate its impact on our conclusions. As such, activities or episodes that transpire subsequent to this Phase I ESA are not considered in this assessment. It is not intended that a Phase I ESA in accordance with ASTM E1527-13 be an exhaustive assessment of a property nor can it wholly eliminate uncertainty regarding the potential for RECs in connection with a property. 1.4 Phase I ESA Assumptions This Phase I ESA Report, including the exhibits attached hereto, describes the results of Roux Associates’ investigation to identify the presence of RECs connected with the Site in accordance with ASTM E1527-13, as allowed by and consistent with the regulatory requirements of the All Appropriate Inquiry (AAI) Rule, 40 CFR Part 312, Amendment to Standards and Practices for All Appropriate Inquires Under CERCLA, Final Rule, published December 30, 2013 (AAI Rule). Specifically, the preamble to the amended AAI Rule states: The Environmental Protection Agency (EPA) today is taking final action to amend the standards and practices for conducting all appropriate inquiries under the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) to reference a standard practice recently made available by ASTM International, a widely recognized standards development organization. Specifically, this final rule amends the ‘‘All Appropriate Inquiries Rule’’ at 40 CFR Part 312 to reference ASTM International’s E1527–13 ‘‘Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process’’ and make clear that p ersons conducting all appropriate inquiries may use the procedures included in this standard to comply with the All Appropriate Inquiries Rule 1. One of the requirements that a person acquiring real property must meet in order to qualify for either the innocent landowner, contiguous owner, or bona fide prospective purchaser (collectively hereinafter “Prospective Purchaser”) defense to liability under the federal Comprehensive Environmental Response , Compensation, and Liability Act of 1980, as amended by the Superfund Amendments and Reauthorization Act of 1986, and the Small Business Liability Relief and Brownfields’ Revitalization Act of 2002, 42 U.S.C. 9601-9675 (collectively referred to hereafter as “CERCLA”) is that person must conduct all appropriate inquiries into the previous ownership and uses of the property in conformance with the AAI Rule (or the ASTM E1527-13) prior to acquisition of the property. The User has acknowledged that, under the AAI Rule, Roux Associates’ performance of this Phase I ESA in accordance with ASTM E1527-13 will not alone result in the User satisfying all requirements of the AAI Rule and will not in itself provide a defense to CERCLA liability. The User has acknowledged that the AAI Rule also requires that the Prospective Purchaser undertake certain additional inquiries and post-acquisition activities to satisfy the CERCLA AAI requirements. Accordingly, Roux Associates makes no guarantees or warranties, expressed or implied, regarding this Phase I ESA, including without limitation, that this Phase I ESA will qualify the User for a defense to CERCLA liabilit y. Roux Associates has performed this Phase I ESA in a professional manner using that degree of skill and care exercised for similar projects under similar conditions by reputable and competent environmental consultants. Professional judgments expressed herein are based on the facts currently available to Roux Associates. 1 Federal Register: December 30, 2013 (Volume 78, Number 250) Page 79319 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 4 The AAI Rule requires, and the conclusions stated herein represent, the application of a variety of engineering and technical disciplines to material facts and conditions associated with the Site. As such, these conclusions are based on subjective interpretations and the exercise of discretion based on the facts available to Roux Associates and conditions at the time of the performance of this Phase I ESA. Many of these facts and conditions are subject to change over time. Accordingly, the conclusions must be considered within this context. The User has agreed that Roux Associates shall not be responsible for conditions or consequences arising from relevant facts that were concealed, withheld, or not fully disclosed at the time this Phase I ESA was performed. To the extent practicable, Roux Associates has identified data gaps, and has evaluated the potential significance of such data gaps. Recommendations to address those data gaps may be provided to the User upon request and are based on the data available at the time of the performance of this Phase I ESA. Implementation of the recommendations may not fully address the data gaps , and the information obtained from execution of those recomm endations may alter and/or modify the interpretation of the Site conditions and conclusions, herein. This Phase I ESA does not include consideration of matters specifically excluded by ASTM E1527-13, including but not limited to, asbestos-containing materials (ACM), radon, lead-based paint (LBP), lead in drinking water, wetlands, regulatory compliance, and mold unless specifically identified herein. Roux Associates has not collected samples at the Site and is relying on information from other sources. By referencing this information, Roux Associates does not accept responsibility for the accuracy of the underlying data, sampling methods, laboratory analysis, or documentation. This Phase I ESA Report should not be considered a legal interpretation of existing environmental laws and regulations. This Phase I ESA was conducted with a reasonable degree of inquiry to identify RECs, but uncertainty is not eliminated. No Phase I ESA can wholly eliminate uncertainty regarding the potential for RECs in connection with a property. The Phase I ESA process is intended to reduce, but not eliminate, the uncertainty involved with identifying RECs. This Phase I ESA Report is not an appraisal or value judgment of the Site. The User has agreed that Roux Associates shall not be liable for any use of this Phase I ESA Report as an appraisal or value judgment of the Site. This Phase I ESA Report has been prepared for the exclusive use of the User for specific application to the Site covered by this Phase I ESA Report. The User has agreed that any third-party use of this Phase I ESA Report, upon disclosure by the User, is the sole responsibility and at the sole liability of the User. 1.5 Phase I ESA Limitations and Exceptions The limitations and exceptions associated with performing this assessment include outstanding Freedom of Information Act (FOIA) requests. These are described as data gaps in Section 6.1. 1.6 Phase I ESA Special Terms and Conditions There were no special terms and conditions associated with performing the Phase I ESA. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 5 1.7 User Reliance This report is confidential and has been prepared for the exclusive use of the User. No additional parties may use the information contained in this report without obtaining the written permission of Roux Associates or the User. Roux Associates’ duties and obligations extend to the User and to no other party. Roux Associates’ duties and obligations to the User are not transferable to persons, corporations, or organizations without the express written consent of the User and Roux Associates. The User may rely upon the information provided in this Phase I ESA report for a period of 180 days from the date of issue. After 180 days, this Phase I ESA should be updated in accordance with ASTM guidance. Roux Associates will not be liable for any consequential damages arising from the use of this report for other than its intended purpose, for use of this report beyond 180 days of its issue date, or from unauthorized use by third parties. This report must be read and interpreted as a whole and can only be considered representative of the conditions of the Site as of the date of our Site reconnaissance described herein. Roux Associates makes no representation whatsoever concerning the condition of the Site beyond the date of our Site reconnaissance described herein. Individual sections and appendices of this report are dependent on the balance of this report, and on the terms, conditions, and stipulations contained in the proposal and written amendments accepted by Roux Associates. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 6 Site Description 2.1 Location and Legal Description The Site is located at the northwest corner of Katella Avenue and Winners Circle in the City of Cypress, California (Figures 1 and 2). According to Mr. Douglas Hawkins, City Planner for the City of Cypress, the Site has never been issued a physical street address. The Site is an approximately 13.29-acre property and identified by APNs 241-091-22, 23, 24, 25, and 26. 2.2 Site and Vicinity General Characteristics The site is currently vacant and is used as a parking lot for the adjacent Los Alamitos Race Course; at the time of the Site reconnaissance the Site was being used for temporary truck trailer parking associated with GES, an events management company. The elevation of the Site is approximately 30 feet above mean sea level (msl) according to several sources, which include Google Earth, topographic maps (Appendix C), and the Environmental Data Resources Inc. (EDR) Radius Map Report (Appendix D). The Site and vicinity are relatively flat sloping gently to the south-southwest. The Site is located in a mixed commercial and residential area. 2.3 Description of Structures, Roads, and Other Site Improvements The Site is currently undeveloped and consists of a flat, surface parking lot, which is mostly paved with the exception of its northeastern quadrant. The Site is accessible from the south by Katella Avenue, from the east by Winners Circle, and from the west by the unnamed Los Alamitos Race Course driveway. There is no physical boundary between the Site and the adjacent parking lot to the north of the Site. 2.4 Current and Past Use of the Site According to aerial photographs, topographic maps, and city directory obtained from EDR, the Site was undeveloped from at least 1896 through 1925. The Site appears to have been utilized for agricultural purposes in 1928 and the Site was vacant from at least 1938 through 1947. The Site was improved with a parking lot before 1963, and it has been generally used for that purpose since that time. 2.5 Current Uses of the Adjoining Properties The Site is located in a mixed commercial and residential area of Cypress, California. The Site is bordered to the west by an entrance to the Los Alamitos Race Course, beyond which is a commercial retail development; parking for the Los Alamitos Race Course is located to the north of the Site; Winners Circle borders the Site to the east, beyond which is Costco and other commercial retail development; and, Katella Avenue borders the Site to the south, beyond which are commercial office properties. No concerns were noted on the adjacent properties during the Site reconnaissance. 2.6 Physical Setting Roux Associates obtained and reviewed published, reasonably ascertainable information concerning the physical setting of the Site. The following is a summary of our review of those physical setting sources. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 7 2.6.1 Surface Water and Drainage The only surface water and drainage features of note on the Site are two surface concrete drainage swales that lead to two drains at the southern portion of the Site. These drains lead directly to storm water drainage pipes that run along Katella Avenue, as confirmed by Mr. Hawkins with the City of Cypress. Aerial photographs from 1977 to 1990 suggest that prior to installation of the drains, surface water ran along the same surface swales into two square unlined features surrounded by small berms. The nearest surface water feature in the Site vicinity is the Rossmoor Storm Channel, which is located approximately 1,500 feet south of the Site. 2.6.2 Physiographic Setting The elevation of the Site is approximately 30 feet above mean sea level. The Site is situated within a physiographic feature called the Downey Plain, which forms a part of the greater coastal plain of the Los Angeles Basin. Recent sediments underlying the Downey Plain region include unconsolidated gravel, sand, silt, and clay originally deposited in a fluvial environment. Below recent Downey Plain alluvial deposits are up to 2,000 feet of Quaternary and Tertiary deposits (Arcadis, 2011). 2.6.3 Regional and Local Geology According to the California Department of Conservation 2010 Geologic Map of California, the Site vicinity is underlain by alluvium, lake, playa and terrace deposits of the Pleistocene-Holocene era, unconsolidated and semi-consolidated. According to documents for subsurface investigations at nearby sites, underlying sediments in the vicinity of the Site primarily consist of fine-grained sands with silt, with lenses of interbedded clays from the ground surface to approximately 20 feet below ground surface (bgs) (Arcadis, 2011). 2.6.4 Regional and Local Hydrogeology According to the California Department of Water Resources (DWR) Groundwater Bulletin 118 – Update 2003, the Site is located in the Coastal Plain of Orange County Groundwater Basin (Orange County Basin). The Orange County Basin consists of an accumulation of fresh water-bearing marine and continental sand, silt, and clay deposits. The Basin consists of the Upper, Middle, and Lower Aquifer system. The Upper Aquifer System averages approximately 800 feet in thickness and includes Holocene and older alluvium deposits, terrace deposits, and upper Pleistocene deposits including the La Habra Formation (DWR, 2003). Roux Associates reviewed the December 2011 Arcadis Confirmation Soil Borings Report for a nearby release case located at 5100 Katella Avenue, approximately 230 feet southwest of the Site. The report is available on the California State Water Resources Control Board (SWRCB) GeoTracker database. Based on the groundwater monitoring data provided in the report, the expected direction of groundwater flow is to the west- southwest in the Site vicinity. This is generally consistent with the topography of the area. The reported depth to groundwater in 2011 was 4.62 to 7.37 feet below ground surface (bgs). 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 8 User-Provided Information ASTM E1527-13 provides that the User perform certain tasks. The purpose of this section is to present select User-provided information that can assist in identifying possible RECs in connection with the Site. According to ASTM E1527-13, these tasks do not require the technical expertise of an environmental professional and the environmental professional generally does not perform these tasks. Roux Associates administered a questionnaire to the User at the beginning of this Phase I ESA to assist them with these tasks. Ms. Elizabeth Cobb of Shea Properties completed the questionnaire, included in Appendix A, on May 8, 2019. According to the questionnaire, Ms. Cobb had no knowledge of current or prior developments on the Site. Ms. Cobb was not aware of any environmental liens, activity and land-use limitations, engineering or institutional controls, chemical releases or contamination on the Site, or environmental cleanups in connection with the Site. 3.1 Environmental Liens or Activity and Use Limitations The User indicated that they have no knowledge regarding environmental liens or activity and use limitations (engineering/institutional controls) with respect to the Site. 3.2 Specialized Knowledge The User did not report any specialized knowledge related to the Site. 3.3 Valuation Reduction for Environmental Issues The User indicated that they have no knowledge regarding valuation reduction for environmental issues. 3.4 Commonly Known or Reasonably Ascertainable Information The User did not have any knowledge regarding commonly known or reasonable ascertainable information about the Site not otherwise addressed. 3.5 Obvious Indicators of the Presence or Likely Presence of Contamination of the Site The User did not have any knowledge regarding obvious indicators of the presence or likely presence of contamination of the Site not otherwise addressed. 3.6 Previous Phase I ESA Report Roux was provided the following previous Phase I ESA for review: Phase I Environmental Site Assessment for Commercial Property, APN’s #241-091-22, 23, 24, 25 & 26, Cypress, CA. 90630, dated August 10, 2006, prepared by DCI Environmental Services (DCI; Appendix E). DCI did not identify any “hazardous substances that pose a threat to the environmental integrity of the Subject Property” and noted that “it does not appear that the Subject Property…is adversely impaired by hazardous 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 9 substances or underground storage tanks” during the preparation of the ESA. The parking lot area of the Site was noted to be in generally good condition during the Site reconnaissance. In their conclusions and recommendations, DCI did not identify any RECs in conjunction with the Site or recommend further environmental investigations. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 10 Records Review The historical uses of the Site and surrounding properties were researched through the review of historical aerial photographs (Appendix F), historical topographic maps (Appendix C), and the EDR City Directory Search (Appendix G) (Section 4.1). No Sanborn Fire Insurance Maps were available for the Site, as indicated in Appendix H. 4.1 Historical Sources Summary The table below provides a historical summary of the Site in 10-year increments using information compiled from historical aerial photographs (Appendix F), historical United States Geological Survey (USGS) topographic maps (Appendix C), and the EDR City Directory Search (Appendix G). The table includes a discussion of pertinent findings, but it is not exhaustive of all historical information that may be available for the Site. Summary of Historical Sources Date Range Site Description Historical Sources Pre-1920 The Site appears to be undeveloped from at least 1896 through the 1910s. Approximately 600 feet north of the Site is a Southern Pacific railroad (Los Alamitos Branch), which is depicted as being installed by 1902. A creek is depicted approximately 0.25 miles east of the Site. Other properties in the vicinity also appear to be mostly undeveloped with the exception of one structure that is present to the east-northeast of the Site near the creek. By 1902 an unlabeled road is present to the immediate south of the Site in the location of present-day Katella Avenue, and other roads are present throughout the Site vicinity. - 1896, 1899, and 1902 USGS Downey Topographic Maps 1920- 1929 The 1923 and 1925 topographic maps do not show details of the Site vicinity. The Site appears to be used for agricultural purposes in the 1928 aerial photograph. One structure that appears to be used for agricultural/homestead purposes is situated approximately 500 feet west of the Site. Other parcels remain undeveloped and appear to be vacant or agricultural. - 1923 and 1925 USGS Artesia Topographic Maps - 1928 EDR Aerial Photograph 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 11 Summary of Historical Sources Date Range Site Description Historical Sources 1930- 1939 The 1935 topographic map depicts a tank farm labeled “Texas Oil Tank Farm ” approximately 0.6 miles north-northwest of the Site. Additional structures are depicted approximately 0.8 miles west-southwest of the Site. The creek formerly depicted to the east of the Site is no longer shown in the 1935 topographic map. Additional roads are shown in the Site vicinity. The road immediately south of the Site is labeled as Katella Avenue. A rectangular feature that appears to be an irrigation pond is depicted approximately 0.7 miles east of the Site. In the 1938 aerial photograph, the Site and vicinity appear to be used for agricultural purposes and appear to be generally consistent with the area shown in the 1928 aerial photograph. - 1935 USGS Los Alamitos Topographic Map - 1938 EDR Aerial Photograph 1940- 1949 The 1942 topographic map depicts additional structures throughout the Site vicinity. Two structures are depicted west adjacent of the Site boundary; however, they are not shown in the 1947 aerial photograph. A structure is depicted approximately 0.2 miles east of the Site. The 1943 topographic map is largely consistent with the 1942 topographic map; the 1945 topographic map does not include details of the Site vicinity. The Site property appears to be undeveloped land in the 1947 aerial photograph, and Site usage is unclear. The Site vicinity has been developed with what appears to be a circular race track approximately 1,000 feet west of the Site. An additional road was constructed sometime before 1947 approximately 1,500 feet south of the Site. Most of the Site vicinity appears to continue to be used for agricultural purposes. The 1949 topographic map depicts a race track approximately 1,000 feet west of the Site, which is consistent with the 1947 aerial photograph. The road shown in the 1947 aerial photograph approximately 1,500 feet south of the Site is depicted as belonging to a “Naval Reservation” shown on the 1949 topographic map. The Naval Reservation includes multiple structures and roads. - 1942 and 1943 USGS Downey Topographic Maps -1945 USGS Artesia Topographic Map -1947 USGS Downey Topographic Map - 1947 EDR Aerial Photograph - 1949 USGS Los Alamitos Topographic Map 1950- 1959 The 1950 topographic map is largely consistent with the 1949 topographic map. In the 1952 aerial photograph, the Site remains undeveloped. The race track remains to the west of the Site. Much of the Site vicinity appears to be used for agricultural purposes. The orientation of the road to the south of the Site associated with the Naval Reservation has changed, and multiple structures that appear to be related to agricultural or livestock use are situated approximately 600 feet southwest of the Site. - 1950 USGS Los Alamitos Topographic Map - 1952 EDR Aerial Photograph 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 12 Summary of Historical Sources Date Range Site Description Historical Sources 1960- 1969 In the 1963 aerial photograph, the majority of the Site appears to have been paved, possibly for use as a parking lot. A roa d appears to be situated across the Site from Katella Avenue to the racetrack. The area immediately south of the Site has been developed with structures that appear to be residential in nature. The race track has moved to the north of the Site, and now contains ponds in the center of the track. The areas adjacent to the Site to the west, north, and east remain undeveloped. A paved surface that appears to be a runway is situated approximately 1,400 feet southwest of the Site The 1964 topographic map depicts the Site as being undeveloped and within or immediately adjacent to a parking area. A road which connects the Los Alamitos Racetrack to Katella Avenue is depicted across the Site. The 1964 topographic map depicts the area immediately to the south and southwest of the Site as red-shaded developed land. The topographic map depicts the Los Alamitos Racetrack as having been relocated to the north of the Site, consistent with the 1962 aerial photograph. The naval installation is now labeled as the “Los Alamitos Naval Air Station”, and a northeast-southwest-trending runway appears to have been developed. The perimeter of the naval station has expanded relative to the perimeter depicted in the 1950 topographic map. The northern boundary of the naval station is now approximately 0.25 miles south of the Site. A feature labeled “Rossmoor Storm Channel” is depicted approximately 0.25 miles south of the Site. A channel labeled “Channel Naval” is depicted approximately 0.75 miles east of the Site. Water tanks are depicted approximately 600 feet northwest of the Site; they may be associated with a golf course depicted on the topographic map approximately 0.25 miles northwest of the Site. A creek labeled “Carbon Creek” is depicted approximately 0.7 miles north of the Site. A feature labeled “pumping station” is depicted at the tank farm north-northwest of the Site. - 1963 EDR Aerial Photograph - 1964 USGS Los Alamitos Topographic Map 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 13 Summary of Historical Sources Date Range Site Description Historical Sources 1970- 1979 In the 1970 aerial photograph, the Site appears to be consistent with the 1963 aerial photograph. The Site vicinity appears to be mostly consistent with the 1963 aerial photograph. The former runway appears to have been truncated, and a pond appears to be situated approximately 1,000 feet southwest of the Site, adjacent to the former runway. In the 1972 topographic map, neither the parking area in the Site vicinity nor the road transiting across the Site are depicted. The majority of the features in the Site vicinity appear to be consistent with those depicted in the 1964 topographic map with the exception of additional development shown throughout the vicinity. The pond feature shown in the aerial photograph is depicted in the topographic map. In the 1977 aerial photograph the Site appears to remain used as a parking lot. Two roughly square areas in the southern portion of the Site appear to be used to collect surface run-off from the Site and of the Race Course to the north, and berms appear to be placed around these features. The approximately square features are located at the southern terminus of the two concrete drainage swales located at the Site. The Site vicinity is largely consistent with the 1970 aerial photograph. - 1970 EDR Aerial Photograph - 1972 USGS Los Alamitos Topographic Map - 1977 EDR Aerial Photograph 1980- 1989 The 1981 topographic map is largely consistent with the 1972 topographic map. The naval facility to the southwest of the Site is now labeled “Los Alamitos Armed Forces Reserve Center”. Development is indicated approximately 700 feet southwest of the Site. The 1981 aerial photograph is generally consistent with the 1977 aerial photograph, with the exception of development to the southwest of the Site that appears to be commercial in nature. The majority of the Site appears to be used as a parking lot. The 1989 aerial photograph is largely consistent with the 1981 aerial photograph. According to Mr. Douglas Hawkins and Mr. Frank Sherren, the parking lot situated on the Site has been in place for at least 30 years and has not been significantly modified or altered since then. - 1981 USGS Los Alamitos Topographic Map - 1981 EDR Aerial Photograph - 1989 EDR Aerial Photograph - Telephone interviews with Mr. Douglas Hawkins and Mr. Frank Sherren, May 14, 2019 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 14 Summary of Historical Sources Date Range Site Description Historical Sources 1990- 1999 The 1990 aerial photograph is largely consistent with the 1989 aerial photograph. A portion of the Site appears to be occupied by parked automobiles. In the 1994 aerial photograph, the two approximately square drainage features situated at the south of the Site appear to have been paved, and it appears that the berm currently situated at the south edge of the Site was constructed or under construction. A structure was developed on the parcel adjacent to the Site to the west in the location of the current Seventh-Day Adventist Church. - 1990 EDR Aerial Photograph - 1994 EDR Aerial Photograph 2000- 2009 A portion of the Site appears to have been repaved in the 2005 aerial photograph; the Site appears to continue to be used as a parking lot. In the northeastern portion of the Site, the surface pavement appears to have been damaged and/or removed. In the southwest portion of the Site there appear to be staged equipment or vehicles. According to Mr. Sherren, construction equipment was being temporarily staged at the Site, which damaged the surface the surface asphalt. An apparently commercial structure was developed by 2005 immediately adjacent to the east of the Site, and various apparently commercial buildings appear in the vicinity to the east of the Site. Multiple apparently commercial structures were also developed on the parcel adjacent to the west of the Site. The Southern Pacific Railroad is no longer visible to the north of the Site. The 2009 aerial photograph is largely consistent with the 2005 aerial photograph. Semi-trailer trucks appear to be parked in the northeastern portion of the Site. An additional commercial structure was developed on the parcel adjacent to the eastern border of the Site. - 2005 EDR Aerial Photograph - 2009 EDR Aerial Photograph - Telephone interview with Mr. Frank Sherren, May 14, 2019 2010- Present The Southern Pacific railroad is no longer depicted to the north of the Site in the 2012 topographic map. The armed forced facility to the south of the Site is now labeled “Los Alamitos Army Airfield”. The tank farm depicted in the 1981 topographic map appears to be developed. The 2012 aerial photograph is largely consistent with the 2009 aerial photograph. The 2016 aerial photograph is largely consistent with the 2012 photograph, with the exception of the development of a structure approximately 250 feet northwest of the Site that appears to be commercial in nature. - 2012 USGS Los Alamitos Topographic Map - 2012 EDR Aerial Photograph - 2016 EDR Aerial Photograph According to the aerial photographs, topographic maps, and city directory obtained for the Site and vicinity from EDR, the Site was undeveloped from at least 1896 through 1925. The Site appeared to be utilized for agricultural purposes in 1928 and the Site was vacant from at least 1938 through 1952. By 1963, the Site 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 15 appears to have been paved and used for parking purposes, and the Site has remained paved and used for parking since that time. According to Mr. Douglas Hawkins, City Planner for the City of Cypress, the Site was purchased in 2006 by the Cypress Redevelopment Agency from the owners of the Los Alamitos Race Track. In 2011, the Site was sold by the Cypress Redevelopment Agency to the City of Cypress, the current owner of the Site. According to historical sources, the Site may have been used for agricultural purposes as early as 1928. Although there is a potential that agricultural chemicals, such as pesticides, herbicides and fertilizers, were used on-Site, based on the limited apparent duration of agricultural activities at the Site historical agricultural usage is not considered a REC. According to historical sources, an oil tank farm was present within one mile of the Site from at least 1935 through 1981. The tank farm is not associated with any release cases identified in any records searches performed during the preparation of this report and is therefore not considered a concern to the Site. 4.2 Database Search Roux Associates used a computerized environmental database and radius map report prepared by Environmental Data Resources Inc. (EDR) to conduct a government records database search of properties of potential environmental concern within a 1-mile radius of the Site. Appendix D contains a complete copy of the EDR Radius Map Report. Roux Associates reviewed the results of the state and federal environmental database searches performed by EDR. The Site target property was not listed in any of the databases queried by EDR. A summary of the properties within the applicable search radius is provided the table below. The remainder of the discussion of environmental databases has been restricted to adjacent facilities and nearby facilities of concern with listings potentially indicative of a release (e.g. NPL; LUST). Nearby Properties of Potential Environmental Concern from EDR Radius Map Report Address Property Listings Database 5122 Katella Avenue Nelson Pai DDS & Susan Ishioka DDS MS Inc.; Barker Robert H. RCRA NONGEN/NLR; EDR HIST AUTO 5100 Katella Avenue Kincher Gary; Union Oil Service Station 5511; Innabi Union 76 #1; Tosco #5680; Service Station 5511; unnamed facility EDR HIST AUTO; LUST, HIST UST; HAZNET, SWEEPS UST, CA FID UST; HIST CORTESE; UST; HIST UST; RCRA-LQG 5074 Katella Avenue Racer Cleaners; Alamitos Cleaners and Laundry; Alamitos Cleaners; Alamitos Laundry & Dry Cleaners DRYCLEANERS; EDR HIST CLEANER; DRYCLEANERS; DRYCLEANERS 5074-78 Katella Avenue Alamitos Cleaners DRYCLEANERS 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 16 4961 Katella Avenue Los Alamitos Race Track; Los Alamitos Race Course FINDS, LUST, RCRA-SQG, HAZNET, SWEEPS UST, CA FID UST, HIST CORTESE, ORANGE CO. INDUSTRIAL SITE, ECHO, CIWQS; AST, LUST, ENF, HIST CORTESE, NPDES, CIWQS 4959 Katella Avenue Island Cleaners EDR HIST CLEANER 4921 Katella Avenue Cypress Golf Club LUST, NPDES 5401 Katella Avenue Replanet LLC SWRCY, CHMIRS 5001 Cerritos Robert Kahn Property/Former HRAKO Service Center LUST 4991 Cerritos Orange County Fire Station #17 LUST, SWEEPS UST, CA FID UST, HIST CORTESE 5730 Katella Avenue R&D Building Parcel 7 HAZNET; ENVIROSTOR; CIWQS 4411 Katella Avenue Vesper Corporation; Arrowhead Products HAZNET, EMI, ENVIROSTOR, CIWQS; ENVIROSTOR 4250 Constitution Avenue Joint Forces Training Base, Los Alamitos – BLDG 34 LUST, ENVIROSTOR, RESPONSE 10800 Valley View Street The Boeing Company HAZNET, EMI, ENVIROSTOR, ORANGE CO. INDUSTRIAL SITE None provided Los Alamitos Rad Bomb/Score Site ENVIROSTOR None provided NAS Los Alamitos ENVIROSTOR None provided Los Alamitos Armed Forces Reserve Center DOD The EDR Search Report identified several listings for off-Site adjacent or nearby properties on databases potentially indicative of a contamination concern. Roux Associates notes that surface topography in the Site vicinity generally slopes to the south-southwest according to historical topographic maps and the EDR Radius Map Report (Appendix D). The listings of potential concern are herein discussed by facility or address. • Nelson Pai DDS & Susan Ishioka DDS MS Inc., located at 5122 Katella Avenue approximately 160 feet southwest of the Site, is listed in the RCRA NONGEN/NLR database. No violations or spills are noted, and inclusion in this database is consistent with general regulatory compliance; therefore, this listing is not considered to represent an environmental concern to the Site. • Barker Robert H., located at 5122 Katella Avenue approximately 160 feet southwest of the Site, is listed in the EDR HIST AUTO database from 1969 to 1983. No evidence of spills or violations is reported for this facility; therefore, this listing is not considered to represent an environmental concern to the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 17 • 5100 Katella Avenue, which is situated approximately 225 feet southwest of the Site, is associated with multiple gasoline station and automotive listings including Kincher Gary, Union Oil Service Station 5511, Innabi Union 76 #1, Tosco #5680, Service Station 5511, and one unnamed facility whose mailing address is associated with Circle K. The facilities at 5100 Katella Avenue are listed in the EDR HIST AUTO, LUST, HIST UST, HAZNET, SWEEPS UST, CA FID UST, HIST CORTESE, UST, and RCRA-LQG databases. Of these listings, only the LUST listing associated with the Tosco #5680 facility is indicative of a release. According to the GeoTracker listing for the Tosco #5680 facility, a gasoline leak from a UST was discovered on May 19, 1987. Remediation of the gasoline leak involved excavation, operation of a groundwater pump and treat system, soil vapor extraction, and ozone injection. The facility received a No Further Action letter on September 23, 2015. Based on the downgradient location of the Tosco #5680 facility and the issuance of regulatory closure for the gasoline leak, this listing is not considered to represent an environmental concern to the Site. • 5074 Katella Avenue, located approximately 410 feet west-southwest and hydraulically downgradient of the Site, is associated with multiple dry cleaner facilities including Racer Cleaners, Alamitos Cleaners and Laundry, Alamitos Cleaners, and Alamitos Laundry & Dry Cleaners. These facilities are listed in the DRYCLEANERS and EDR HIST CLEANER listings. The listings for Racer Cleaners, Alamitos Cleaners, and Alamitos Laundry & Dry Cleaners are associated with perchloroethylene; however, there are no listings indicative of environmental releases and therefore these listings are not considered to represent an environmental concern to the Site. • Los Alamitos Race Track and Los Alamitos Race Course are listed at 4961 Katella Avenue in the FINDS, LUST, RCRA-SQG, HAZNET, SWEEPS UST, CA FID UST, HIST CORTESE, ORANGE CO. INDUSTRIAL SITE, ECHO, CIWQS, AST, ENF, NPDES, and CIWQS databases. According to the EDR Radius Map Report the facility is listed as being located approximately 550 feet west- southwest of the Site; however, it is situated adjacent to the Site to the north. With the exception of the listings described below, the inclusion of this facility in these databases is indicative of general regulatory compliance. The LUST cases identified for this facility are for leaks that are reported to have been discovered on August 9, 1988 and June 23, 1997. The leak discovered August 9, 1988 received regulatory closure on June 26, 1996 according to the LUST database listing. The Orange County Environmental Health Division Remedial Action Case Closure Summary associated with this leak indicates that four diesel USTs containing gasoline and diesel were removed from the property. Soil sampling following UST removal indicated that the tank pit area was heavily contaminated, and free product was observed floating on groundwater in the tank pit. Vapor extraction, groundwater extraction and implementation, and bioremediation were implemented. Carbon tetrachloride and 1,2-DCA are reported to have been detected in several monitoring wells at the facility; the origins of these contaminants was allegedly unknown. Prior to closure, only one monitoring well was reported to show impacts related to the former USTs in the form of elevated benzene. However, the LUST case subsequently received closure. The leak discovered June 23, 1997 received closure on July 29, 1997 according to the LUST database listing. Files available on GeoTracker corresponding to this leak indicate that soil testing following the removal of three USTs indicated low levels of gasoline, diesel, and MTBE 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 18 contamination. Approximately 5 tons of contaminated soil was moved to an open area at the race track, and fertilizer and water were added to the spoils. The spoils were spread across the track area and were left in place for the contamination to naturally attenuate. Based on the closure status of both LUST cases, these listings are not considered to represent an environmental concern to the Site. The FINDS listing associated with the Los Alamitos Race Course facility indicates that the facility was in violation of the Clean Water Act in 2018 and 2019 for best management practice deficiencies, discharge without a permit, failure to monitor, and for not submitting an annual report. Based on the lack of documented environmental release, this listing is not considered to represent an environmental concern to the Site. • Island Cleaners, located at 4659 Katella Avenue, is listed in the EDR HIST CLEANER database and was also observed to be present at that location during the Site reconnaissance. Island Cleaners is approximately 550 feet west-southwest of the Site. There are no releases or violations associated with this facility, and this listing is not considered to represent an environmental concern to the Site. • Cypress Golf Club, located at 4921 Katella Avenue, is listed in the LUST and NPDES databases. The Cypress Golf Club was situated approximately 550 feet west-northwest of the Site. According to the GeoTracker listing associated with this facility, a UST formerly used to store gasoline and diesel was removed in March 2004. A grab water sample from the saturated zone showed elevated levels of MTBE, and three groundwater monitoring wells were subsequently installed. Groundwater samples showed low levels of NTBE and other contaminants below risk levels, and the case received closure from the Orange County Environmental Health Division on January 16, 2007. Based on the low concentrations of MTBE and other contaminants associated with the LUST case and the regulatory closure issued, this listing is not considered to represent an environmental concern to the Site. • Replanet LLC at 5401 Katella Avenue, approximately 585 feet east-southeast of the Site, is listed in the CHMIRS database for a Freon gas leak indicated by an alarm panel on June 9, 2006. The CHMIRS listing reports that 0.000000 gallons of Freon gas were spilled, and this this listing is not considered to represent an environmental concern to the Site. • The Los Alamitos Armed Forces Reserve Center is listed in the DOD database, and is listed as being approximately 1,220 feet south of the Site. The Los Alamitos Armed Forces Reserve Center listing is not associated with an address, and the DOD database listing does not have any information regarding environmental releases. Therefore, this listing is not considered to represent an environmental concern to the Site. • The Robert Kahn Property/Former HRAKO Service Center located at 5001 Cerritos Avenue is approximately 0.4 miles north-northwest of the Site and is associated with a LUST case. According to information available on GeoTracker pertaining to the Robert Kahn Property/Former HRAKO Service Center facility, a gasoline leak discovered on August 27, 1991 impacted groundwater. Cleanup involved excavation which was completed on January 26, 1998. The facility received closure on June 11, 2002. Based on the distance from this facility to the Site and the regulatory closure achieved, this listing is not considered to represent an environmental concern to the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 19 • Orange County Fire Station #17 located approximately 0.4 miles north-northwest of the Site is listed in the LUST, SWEEPS UST, CA FID UST, and HIST CORTESE databases. Only the LUST listing is indicative of an environmental release. According to documents available on GeoTracker pertaining to this facility, a UST leak was discovered on July 30, 1997. One 1,000-gallon diesel UST and one 550-gallon gasoline UST were removed from the facility on April 1, 1998. Soils in the immediate vicinity of the tanks and former dispenser area were noted to be contaminated by TPH, toluene, ethylbenzene, and xylenes but the lateral extent of the contamination was noted to be limited. Groundwater samples showed limited MTBE impacts; all other contaminants were below detection limits or respective MCLs. A dual-phase extraction pilot test was conducted, but was deemed not feasible based on limited hydrocarbon recovery. The MTBE concentration in groundwater showed a decreasing trend following tank excavation. Based on these factors, no further action was recommended and the facility received regulatory closure on December 20, 2004. Given the distance from the Site to this facility and the regulatory closure obtained for the LUST case, the Orange County Fire Station #17 listing is not considered to represent an environmental concern to the Site. • R&D Bldg Parcel 7 is listed in the HAZNET, ENVIROSTOR, and CIWQS databases; of these listings, only the ENVIROSTOR database is indicative of potential environmental releases at the facility. R&D Bldg Parcel 7 is located at 5730 Katella Avenue, approximately 0.4 miles east-southeast of the Site. According to the EnviroStor listing for this address associated with Rolls-Royce High Temperature Composite, Inc., the facility has an active tiered permit. A tiered permit checklist submitted July 18, 2018 by the facility indicates that a Phase I ESA conducted in April 2015 did not identify any RECs in conjunction with the facility. No releases are indicated on the EnviroStor listing for the facility. Based on the absence of known releases, this listing is not considered to represent an environmental concern to the Site. • Vesper Corporation and Arrowhead Products are listed at 4411 Katella Avenue, approximately 0.7 miles west of the Site, and are listed in the HAZNET, EMI, ENVIROSTOR, and CIWQS databases. This facility is approximately 3,600 feet west of the Site. According to the EnviroStor listing associated with Arrowhead Products, the company moved to its Los Alamitos location in 1962 and was sold to Vesper Corporation in 1983. The facility continues to operate as Arrowhead Products and manufactures metallic and non-metallic bellows and ducting systems, reinforced plastic structures, composite laminates, and thermal protective products for the aerospace and defense industries. According to the EnviroStor listing for the facility, contaminants found at the facility include arsenic in soil and VOCs in soil, soil gas, and indoor air. VOCs identified at the facility include TCE and PCE. According to the Preliminary Endangerment Assessment (PEA) Report prepared for the facility, groundwater is encountered between 8 and 12 feet below ground surface. Based on the relatively shallow groundwater depth, the PEA Report recommended that groundwater samples be collected to evaluate for the presence of VOCs. Although the presence of VOC contamination in groundwater at the Arrowhead Products facility has not been evaluated, based on the distance to the Site this listing is not considered to represent an environmental concern to the Site. • The Joint Forces Training Base, Los Alamitos – BLDG 34 facility located at 4250 Constitution Avenue is listed in the LUST, ENVIROSTOR, and RESPONSE databases. The facility associated with this listing is situated on the Los Alamitos Joint Forces Training Base approximately 3,630 feet west- southwest of the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 20 According to the GeoTracker listing for this facility, the cleanup status is Open – Remediation as of June 15, 2007. Six USTs were historically associated with BLDG 34, and were removed from March to May 1994 along with 225 cubic yards of petroleum-impacted soil. A soil vapor and groundwater treatment system was operated from September 2006 through March 2007, and oxygen release compound was applied in May 2007 in 44 locations. Following these remedial activities, long-term groundwater monitoring was implemented. As of 2016, additional assessment is needed to determine the vertical and lateral extent of petroleum impacts. The RESPONSE listing for the BLDG 34 facility lists the status as No Further Action as of February 3, 2010. The potential contaminants are listed as munitions debris. According to the EnviroStor listing for the Joint Forces Training Base that BLDG 34 is a part of, potential contaminants of concern include explosives, metals, and munitions debris. The cleanup status is listed as No Further Action as of February 3, 2010. Based on the distance to the Site and the remediation that has occurred associated with the LUST case, these listings are not considered to represent an environmental concern to the Site. • The Boeing Company located at 10800 Valley View Street is listed in the HAZNET, EMI, ENVIROSTOR, and ORANGE CO. INDUSTRIAL SITE databases. The Boeing Company facility is situated approximately 4,020 feet east of the Site. Of the database listing for the Boeing Company facility, only the ENVIROSTOR and ORANGE CO. INDUSTRIAL SITE listings are indicative of environmental releases. The ENVIROSTOR listing for the facility lists the status as Refer: 1248 Local Agency as of September 2, 2004. There are no potential contaminants or affected media noted in the EnviroStor listing for the facility. According to the ORANGE CO. INDUSTRIAL SITE listing for the facility, closure certification was issued on January 27, 2005 for a release of oil and water. Based on the regulatory closure issued for the oil and water release and the distance from the Site, these listings are not considered to represent an environmental concern to the Site. • Los Alamitos Rad Bomb/Score and NAS Los Alamitos are not associated with an address. Both facilities are listed as being situated 5,050 feet southwest of the Site, and both facilities are associated with an ENVIROSTOR listing. According to the EnviroStor page for NAS Los Alamitos, there are no specified contaminants of concern and the status is Inactive – Needs Evaluation as of July 1, 2005. According to the EnviroStor page for Los Alamitos Rad Bomb/Score Site, potential contaminants of concern include explosives. The status for this facility is Inactive – Needs Evaluation as of August 14, 2018. Based on the distance from the Site to these facilities and the lack of documented environmental releases, these listings are not considered to represent an environmental concern to the Site. One listing was identified as an orphan site and is described in the table below. Orphan Site Listings from EDR Radius Map Report Address Property Listing Database Northeast Corner Los Alamitos and Katella Benjamin B & Maria L Barajas DBA DRYCLEANERS 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 21 The orphan listing is discussed below. •Benjamin B & Maria L Barajas DBA is located on the northeast corner of Los Alamitos Boulevard and Katella Avenue in Los Alamitos, approximately two miles west of the Site. The facility is listed as a dry cleaning facility. This listing is not expected to represent a significant environmental concern to the Site based on the distance from the Site. 4.3 Information from Government Agencies Roux Associates contacted selected federal, state, and local regulatory agencies to determine whether they have potentially relevant environmental records pertaining to the Site, including records relating to USTs, aboveground storage tanks (ASTs), environmental permits, enforcement orders, reports and correspondence related to Site assessment, soil sampling, monitoring, clean-up and/or remediation, removal actions, closures, or any records related to conditions in air, soil, surface water, groundwater, or other environmental media. The agencies contacted and Roux Associates’ interactions with them are documented below. Roux Associates contacted or reviewed information from the following agencies: •Federal; o United States Environmental Protection Agency (EPA), o National Pipeline Mapping System (NPMS), •State; o State Water Resources Control Board (SWRCB): GeoTracker, o SWRCB: Storm Water Multiple Application and Report Tracking System (SMARTS), o Department of Toxic Substances Control (DTSC), o DTSC: EnviroStor, o DTSC: Hazardous Waste Tracking System (HWTS), o California Air Resources Board (CARB), o California Office of Environmental Health Hazard Assessment (OEHHA), o CalEPA: CalRecycle, o CalRecycle: Solid Waste Information System (SWIS), o State of California Department of Conservation: Division of Oil, Gas and Geothermal Resources (DOGGR), •County/Regional; o Santa Ana Regional Water Quality Control Board (SA-RWQCB), o South Coast Air Quality Management District (SC-AQMD), o Orange County Sanitation Department (OCSD), o Orange County Public Works (OCPW), o Orange County Environmental Health, o Orange County Waste and Recycling, and •City/Local; o City of Cypress – City Clerk. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 22 It is noted that the Site does not have a physical street address and therefore the requests were made using the general location of the Site (northwest corner of Katella and Winners Circle), as well as APNs (241-091- 22, 23, 24, 25, and 26). Some agencies require physical street addresses and therefore were unable to respond, as explained below. The following sections summarize Roux Associates’ review of those records. Copies of the records are provided in Appendix I – Regulatory Records Documentation. 4.3.1 Federal Agencies US EPA Roux Associates submitted an online Public Records Request on FOIA online on May 8, 2019. A response dated May 89 [sic] 2019 stated that any available records are available on the EPA MyProperty database, and the request was subsequently closed. NPMS Roux Associates queried the online NPMS Public View database on May 8, 2019. There are no gas transmission or hazardous liquid pipelines within the Site. The nearest pipe is a hazardous liquid pipeline, approximately 0.5 miles north of the Site. 4.3.2 State Agencies SWRCB: GeoTracker Roux Associates queried the online SWRCB GeoTracker database on May 8, 2019. No listings associated with the Site were identified on GeoTracker. One facility, listed below, was identified in the immediate vicinity of the Site and is discussed in greater detail in Section 4.2. •Tosco – 76 # 5511 at 5100 Katella is a closed LUST case. SWQCB SMARTS Roux Associates queried the online stormwater public database on May 8, 2019. No listings associated with the Site were identified. DTSC Roux Associates submitted a Public Records Request form to DTSC via email on May 8 , 2019. On May 13, 2019, a response was received via email stating that there were no records associated with the Site. DTSC: EnviroStor Roux Associates queried the online EnviroStor database on May 8, 2019. No listings associated with the Site or in the immediate Site vicinity were identified. DTSC: HWTS Roux Associates queried the online tracking database on May 8, 2019. No listings associated with the Site were identified. CARB Roux Associates submitted a Public Records Request to CARB via email on May 8, 2019. On May 22, 2019 an email response was received stating that no records associated with the Site were identified. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 23 California OEHHA Roux Associates submitted a Public Records Request to OEHHA via email on May 8, 2019. At the time of this report, no response has been received. CalEPA: CalRecycle Roux Associates submitted a Public Records Request to CalRecycle via email on May 8, 2019. On May 20, 2019 an email response was received stating that no records associated with the Site were identified. CalRecycle: SWIS Roux Associates queried the online SWIS Facility and Site database on May 8, 2019. No listings associated with the Site were identified. State of California Department of Conservation: DOGGR Roux Associates queried the online DOGGR database on May 8, 2019. No listings associated with the Site or within the vicinity of the Site were identified. 4.3.3 County/Regional Agencies SA-RWQCB Roux Associates submitted a Public Records Request to SA-RWQCB via email on May 8, 2019. At the time of this report, no response has been received. SC-AQMD Roux Associates submitted a Public Records Request to SC-AQMD via email on May 8, 2019. A response dated May 9, 2019 stated that the request could not be fulfilled because SC-AQMD can only search by address. Roux Associates also queried the online SC-AQMD database on May 8, 2019. No listings associated with the Site were identified. OCSD Roux Associates submitted a Public Records Request to OCSD on May 8, 2019. On May 8, 2019, a response was received via email, stating that no records associated with the Site were identified. OCPW Roux Associates submitted a Public Records Request to the Orange County web portal on May 8, 2019. On May 15, 2019, a response was received via email stating that one record was available. The record provided describes the discharge of wastewater to the municipal storm water system at 5275 Orange Avenue, Cypress, California on September 13, 2003. This address is approximately 1.4 miles north of the Site; therefore, this incident is not considered an environmental concern to the Site. Orange County Environmental Health Roux Associates submitted a Public Records Request to the Orange County web portal on May 8, 2019. A response received via email on May 8, 2019 stated that the request could not be fulfilled because Orange County Environmental Health can only search by address. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 24 Orange County Waste and Recycling Roux Associates submitted a Public Records Request to the Orange County web portal on May 8, 2019. A response was received via email on May 10, 2019 stating that no records associated with the Site were identified. 4.3.4 City/Local Agencies City of Cypress – City Clerk Roux Associates submitted a Public Records Request via email on May 8, 2019. According to a response dated May 14, 2019, the City of Cypress did not identify records associated with the Site. Roux Associates spoke with Mr. Douglas Hawkins, City Planner for the City of Cypress, by telephone on May 14, 2019 regarding the Site. Information regarding the Site obtained from the interview is described in Section 4.1. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 25 Site Reconnaissance Roux Associates representatives Messrs. Mauricio Escobar and Mark Edwards conducted a visit of the Site and surrounding areas on May 13, 2019. During the Site reconnaissance, it was generally partially cloudy and dry. Roux Associates was unaccompanied during the Site reconnaissance. Site access was unobstructed, and the reconnaissance was conducted on foot. Following the Site reconnaissance, Roux Associates spoke with Mr. Douglas Hawkins, City Planner for the City of Cypress, and Mr. Frank Sherren, Facilities Manager at Los Alamitos Race Course, by phone. Information obtained from these interviews is detailed in Section 4.1 of this report. Roux Associates observed an active geotechnical investigation at the southwestern portion of the Site and evidence of historical boring location (presumably former geotechnical investigations) at various locations throughout the Site. 5.1 Methodology and Limiting Conditions Roux Associates’ Site reconnaissance methods included a site visit to physically observe the Site to identify RECs in connection with the Site. Mr. Escobar and Mr. Edwards traversed the Site on foot to observe conditions. Photographs taken to document conditions encountered at the time of the site reconnaissance are included in Appendix J – Photographic Log. Roux Associates also visually and/or physically observed adjoining properties from reasonably accessible locations on the Site and public thoroughfares. The Site was observed to be flat, undeveloped land used for parking and temporary storage of truck trailers. On-Site improvements consisted of asphalt pavement, which is in disrepair throughout much of the Site, light poles, and surface swales leading to two individual drains that connect to the storm sewer along Katella Avenue. Landscaping including trees and grass were observed along the southwestern border of the Site. Standing water and muddy conditions were observed at the southwestern corner of the Site, which appeared to be from overwatering of the landscaping. A surface berm, which was a landscaping feature, was observed running along the entire length of the southern Site boundary adjacent to Katella Avenue. On-Site topography slopes gently to the south but there appear to be artificial low spots on the southern portion of the Site, likely associated with the surface drains. It was noted that on-Site surface elevation at the southeastern corner of the Site was several feet higher than the surrounding elevation at Winners Circle. It was also noted that the pavement is missing at the northeastern portion of the Site with numerous ruts, which were likely created by large trucks that were observed running through the Site. Gravelly material suggesting road base was observed in this area of the Site. Mr. Sherren indicated that this area of the Site was formerly used to stage construction equipment, which also damaged the former asphalt. The Site is bounded by a fence to the south, by a paved race track entrance to the west, by a parking area for the Los Alamitos Race Course to the north, and by Winners Circle and Costco to the east. According to Mr. Hawkins and confirmed by Mr. Sherren, long-haul trucks are allowed to temporarily park empty trailers at the Site. 5.2 Interior and Exterior Observations The following sections summarize Roux Associates’ Site reconnaissance observations. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 26 5.2.1 Drainage Swales or Culverts Roux Associates observed two shallow concrete drainage swales within the Site parking lot. The swales originate from the north of the Site and generally trend north-south. No hazardous substances, staining, or other indications of a release were observed in the vicinity of the swales. 5.2.2 Drains, Sumps, Wells, or Subsurface Piping Roux Associates observed two stormwater drains in the southern portion of the Site. The drainage swales located on the parking lot lead to the drains, which empty to the storm sewer that runs along Katella Avenue. No hazardous substances, staining, or other indications of a release were observed in the vicinity of the drainage features. A capped pipe labeled ‘LASCO PVC 8”’ was observed in the southern portion of the Site. 5.2.3 Equipment Suspected to Contain Polychlorinated Biphenyls Roux Associates observed one aboveground pad-mounted transformer in the southwest corner of the Site and two aboveground pad-mounted transformers in the southeast corner of the Site. The transformers appeared to be owned and operated by Southern California Edison. It is unknown whether the observed transformers contained oils and potentially PCBs, although this is unlikely given the labeled manufacturing dates of the transformers which ranged from 2010 to 2017. No staining or leaks were observed in the vicinity of the transformers and the pads appeared to be in good condition. Maintenance of the transformers would be the responsibility of Southern California Edison. Roux considers the potential environmental impact associated with the transformers to be low. 5.2.4 Pools of Liquid Pools of liquid (irrigation water) were observed in the southwestern corner of the Site. No visual or olfactory evidence was observed to indicate that the pools of liquid contained anything other than water from adjacent irrigation. 5.2.5 Solid Waste Roux Associates observed minor evidence of general refuse and waste throughout the Site. Small amounts of trash from consumer products were observed in various locations throughout the Site. 5.2.6 Stained Pavement Roux Associates observed minor staining in various portions of the parking lot at the Site. The staining appeared to originate from motor vehicle leaks. Based on the small apparent quantities of leaked automotive fluids, the staining is considered de minimis in nature. 5.2.7 Other Features The following features were not observed by Roux Associates during the May 13, 2019 Site inspection: •Areas of stressed vegetation •Areas which receive flood or storm water from potentially contaminated areas •Air compressor vent discharges •Discharge areas •Drums 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 27 •Empty hazardous substance or petroleum product containers •Hazardous substances and petroleum products •Incinerators •Landfills or landfarms •Loading and unloading areas •Non-contact cooling water discharge •Open areas away from production areas •Stockpiled soil •Unidentified substances containers assumed to contain or once contain automobile-related chemicals •Unusual odors •USTs or other storage tanks •Wastewater, wells, septic systems •Wetland areas, pits, ponds, or lagoons •The site is currently vacant with no structures; therefore, ACM and LBP are not a concern. 5.2.8 Vapor Intrusion Roux considered likely sources of on-site vapor intrusion and off-Site vapor migration during the preparation of this Phase I ESA. None of the features identified at the Site are considered to be a likely source of soil vapor impacts. None of the adjoining or nearby properties were identified as likely source for vapor encroachment onto the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 28 Findings 6.1 Data Gaps During conduct of this ESA, the following data gaps were identified: •The following agency FOIA requests are pending as of this report date: a.California Office of Environmental Health Hazard Assessment (OEHHA) b.Santa Ana Regional Water Quality Control Board (SA-RWQCB) Based on the quality of information obtained from other sources including aerial photographs, topographic maps, and interviews, these data gaps are not considered significant and are not expected to alter Roux Associates’ findings. Roux Associates has performed this Phase I ESA in general compliance with the scope and limitations of ASTM E1527-13. Roux Associates separated the findings of this assessment into the following four categories: RECs, CRECs, HRECs, and de minimis conditions. 6.2 Recognized Environmental Conditions Roux Associates identified the following REC in connection with the current and historical operations at the Site or nearby properties: •REC-1: Disturbed/Imported Soils. Areas of historically disturbed and/or imported soils were identified along the southern and eastern boundaries of the Site. Aerial photographs from 1977 to 1990 suggest that two roughly square areas surrounded by earthen berms were being used to collect surface run-off from the Site and a portion of the Race Course to the north. Also, during the Site reconnaissance an approximately 5-foot high berm was observed along the length of the southern boundary, immediately adjacent to Katella Avenue; it is apparent from aerial photographs this was a feature that was emplaced in the mid-1990s. Additionally, near the southeastern corner of the Site, on-Site topography is several feet higher than the surroundings. Finally, aerial photographs show a construction staging area at the northeastern portion of the Site in the mid-2000s, which was confirmed by Mr. Frank Sherren who works for the Race Course and is knowledgeable of historical Site activities. During the Site reconnaissance it was noted that this northeastern area of the Site is missing surface pavement and coarse gravels resembling road base appeared to have been brought to the Site. Evidence of disturbed and possibly imported materials is considered a REC for the Site. Based on the identification of this REC, Roux Associates performed a limited subsurface investigation at the Site. The methods, results, and conclusions of this investigation are presented in Section 7 of this report. 6.3 Controlled Recognized Environmental Conditions Roux Associates did not identify evidence of CRECs in connection with the current and historical operations at the Site or nearby properties. 6.4 Historical Recognized Environmental Conditions Roux Associates did not identify evidence of HRECs in connection with the current and historical operations at the Site or nearby properties. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 29 Phase II Limited Soil Investigation On June 7, 2019, Roux Associates performed a Phase II Limited Soil Investigation at the Site to address disturbed and possibly imported materials along the southern and eastern portions of the Site (REC-1). This section details the activities performed during the limited soil investigation, describes the analytical results obtained for shallow soil samples from the Site, and presents conclusions based on the data obtained. 7.1 Methods of Investigation 7.1.1 Pre-Field Activities Roux Associates prepared a Site-specific Health and Safety Plan (HASP) to identify potential significant risks and hazards that could have been encountered during implementation of the scope of work. Prior to the start of fieldwork, field workers acknowledged their familiarity with all safety procedures and indicated their intent to follow the HASP by signing the HASP following a tailgate safety meeting. Roux Associates notified Underground Service Alert (USA) of intended subsurface work at the Site at least 48 hours prior to fieldwork by updating DigAlert ticket number A191280457. 7.1.2 Soil Sampling Methodology and Sample Collection Soil sampling locations were selected along the southern and eastern portions of the Site to address fill materials suspected at the Site (Figure 3). Specifically, •Two borings (SS-1 and SS-2) were placed at the northeastern corner of the Site in an area characterized by damaged or missing pavement; •Two borings (SS-3 and SS-4) were placed at the southeastern corner of the Site in an area with higher elevation than the adjacent Winners Circle, •Three borings (SS-5 through SS-7) were placed within the soil berm that runs along the southern edge of the Site; and, •One boring (SS-8) was placed near the central portion of the Site. On June 7, 2019, Roux Associates personnel collected soil samples from all eight borings using hand tools. Discreet samples were collected from all borings at depths of 0.5 and 1.5 feet bgs. At boring locations covered with paving, asphalt was removed prior to collecting samples with a mechanical hand auger; asphalt thicknesses ranged from approximately 2 to 4 inches. Once the asphalt was removed, the hand auger was advanced and soil samples were collected directly into laboratory-supplied glass jars. The samples were then labeled and placed on ice. At boring locations situated in landscaped areas, grass was removed from the boring location prior to advancing the hand auger. Following sample collection, all borings were backfilled using native soil material, and in paved areas the boring was patched using asphalt cold patch to match the existing grade. Soils encountered generally consisted of silts and sands. Visual cues did not suggest evidence of contamination for any of the shallow or deeper samples collected. Between all boring locations, the hand auger bucket was decontaminated using Alconox detergent and deionized water and paper towels. A “dry- wipe” decontamination method was employed during the entire Phase II Limited Soil Investigation, and no investigation-derived waste was generated. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 30 7.1.3 Laboratory Analyses A total of 16 soil samples were collected during this investigation, including eight “shallow” samples from 0.5- feet bgs, and eight “deeper” samples from 2-feet bgs. All 16 samples were transported under chain-of- custody protocol to Enthalpy Analytical, Inc. (Enthalpy) of Orange, California, a California state-certified fixed laboratory, and submitted for potential laboratory analysis on the day of collection. All shallow soil samples were analyzed for Title 22 Metals using United States Environmental Protection Agency (USEPA) Methods 6010B and 7471A. Additionally, one randomly selected shallow sample (SS-2-0.5) also was analyzed for Total Petroleum Hydrocarbons (TPH) using USEPA method 8015M and Volatile Organic Compounds (VOCs) using USEPA Method 8260B. All deeper samples were held by the laboratory pending laboratory results of the shallow soil samples. The analytical results are attached as Appendix K and are presented in Table 1. 7.2 Results Reported soil metals, TPH, and VOC concentrations were compared to applicable and available published screening levels, including USEPA Regional Screening Levels (RSLs) for residential soil, the Department of Toxic Substances Control (DTSC) Human Health Risk Assessment (HHRA) Human and Ecological Risk Office (HERO) Note Number 3 - Soil Screening Levels (SLs) for Residential Soil, and/or San Francisco Regional Water Quality Control Board (SF-RWQCB) Environmental Screening Levels (ESLs). Metals concentrations were also compared with background concentrations identified in California soils. A summary of the soil laboratory results are presented in Table 1 and presented below: •Metals: California Title 22 Metals were analyzed for the eight shallow samples (SS-1-0.5 through SS-8-0.5) collected at the Site. Antimony, arsenic, barium, cadmium, chromium, cobalt, copper, lead, molybdenum, nickel, vanadium, and zinc were reported in one or more samples above laboratory method reporting limits (MRLs). With the exception of arsenic, concentrations of all Title 22 Metals were below applicable screening levels. o Arsenic: Concentrations of arsenic in shallow soils analyzed from the Site ranged from 2.99 milligrams per kilogram (mg/kg) to a maximum of 11.7 mg/kg. These concentrations exceed the USEPA RSL of 0.68 mg/kg, the DTSC HERO Note 3 residential soil SL of 0.11 mg/kg, and the SF-RWQCB ESL of 0.26 mg/kg. However, the measured concentrations of arsenic in Site soils are below the upper-bound background concentration of arsenic in California (DTSC). Therefore, arsenic concentrations are not considered a concern for Site soils. Based on the reported concentrations of metals at the Site which, with the exception of arsenic as discussed above, fall below applicable screening levels, metals are not considered a concern for Site soils. •TPH: One randomly selected soil sample, SS-2-0.5, was analyzed for TPH by USEPA Method 8015M. TPH fractions C6-C12 and C13-C22 concentrations were below their respective laboratory MRLs. TPH fraction C23-C44 was reported at a concentration of 73 mg/kg, which is below the applicable SF-RWQCB screening level for motor oil of 12,000 mg/kg. Based on this result, TPH is not considered a concern for Site soils. •VOCs: One randomly selected soil sample, SS-2-0.5, was analyzed for VOCs by USEPA Method 8260B. No VOC constituents were reported above their respective laboratory MRLs in this sample. Based on this result, VOCs are not considered a concern for Site soils. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 31 Soil samples were generally free from staining or odor and no visual indications of subsurface impacts were identified during this investigation. 7.3 Conclusions and Recommendations Shallow soil samples were collected from eight locations across the Site and were analyzed for California Title 22 metals, TPH (one sample only), and VOCs (one sample only). Laboratory reports showed that Title 22 metals concentrations for all samples analyzed were within acceptable background ranges. Additional analyses showed TPH concentrations below actionable levels and VOC concentrations below laboratory method reported limits (MRLs) for all constituents in the one sample analyzed. Based on the results of the Phase II Limited Soil Investigation, REC-1 has been addressed and Roux Associates does not recommend any additional investigation at the Site. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 32 Deviations Roux Associates performed this assessment in accordance with the generally accepted practices for environmental assessments at the time of implementation, except for the limitations described in Section 1.5. Roux Associates made a reasonable effort to ensure that the information presented in this report is materially complete and accurate. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 33 References American Society for Testing Materials (ASTM) Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process (ASTM E1527-13) Arcadis, Confirmation Soil Borings Report, 76 Service Station 5511, 5100 Katella Avenue Los Alamitos, California California Department of Water Resources, Bulletin 118 – Update 2003, October 1, 2003 DCI Environmental Services, Phase I Environmental Site Assessment for Commercial Property APN’s #241-091-22, 23, 24, 25 & 26, Cypress, CA. 90630, August 10, 2006 DTSC, Determination of a Southern California Regional Background Arsenic Concentration in Soil. Undated. EDR, The EDR Radius Map™ Report with GeoCheck®, May 8, 2019 EDR, The EDR Aerial Photo Decade Package, May 9, 2019 EDR, EDR Certified Sanborn® Map Report, May 8, 2019 EDR, EDR Historical Topographic Map Report, May 8, 2019 EDR, The EDR-City Directory Image Report, May 13, 2019 Kearney Foundation of Soil Science Division of Agriculture and Natural Resources, University of California, Background Concentrations of Trace and Major Elements in California Soils, March 1996. 2217.0014L.100/R Phase I ESA and Phase II Limited Soil Investigation | ROUX | 34 Signature of Environmental Professional Roux Associates completed a Phase I ESA and Phase II Limited Soil Investigation for the approximately 13.29-acre property located at the northwest corner of Katella Avenue and Winners Circle in the City of Cypress, California. The Phase I ESA was performed in general compliance with the scope and limitations of ASTM E1527-13 of the Site, “We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental professional as defined in §312.10 of 40 CFR 312” and, “We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject property. We have developed and performed the all appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312.” Roux Associates performed this Phase I ESA and Phase II Limited Soil Investigation by, or under direct supervision of, the undersigned environmental professionals. Resumes are included in Appendix L - Personnel Qualifications. Respectfully Submitted, Mark A. Edwards, GIT Staff Geologist Mauricio H. Escobar, PG Principal Geologist Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX FIGURES 1.Site Location Map 2.Site Plan 3.Soil Boring Locations Prepared by: ME Project Mgr: MHE Compiled by: ME Office: LA Scale: 1:31,680 Date: 5/15/2019 Project:2217.0014L000File No: F(AP) FIGURE 1 SHEA PROPERTIES SITE LOCATION MAP NORTHWEST CORNER, KATELLA AVENUE AND WINNERS CIRCLE CYPRESS CALIFORNIA Title: Prepared For:S:\Los Angeles\Clients\Shea Properties\Cypress\Phase I\05 - Workables\02 - Figures\GIS\Figure 1 - Site Location Map.mxd £ 0.25 0 0.25 0.5 Miles ") CA LOCATION OF DETAIL SITE Prepared for:Title:Compiled by: Prepared by:Project Mgr:File:Date:Project:Scale:FIGUREROUX2SITE MAPNW CORNER KATELLA AVENUE AND WINNERS CIRCLECYPRESS, CA 90720SHEA PROPERTIESA.T.A.T.M.E.10MAY2019AS SHOWN2217.0014L0002217.0014L000_SITE VICINITY.DWGS:\LOS ANGELES\CLIENTS\SHEA PROPERTIES\CYPRESS\PHASE I\05 - WORKABLES\02 - FIGURES\CAD\2217.0014L000_SITE VICINITY.DWG Prepared for:Title:Compiled by: Prepared by:Project Mgr:File:Date:Project:Scale:FIGUREROUX3SITE MAP WITH SOILBORING LOCATIONSNW CORNER KATELLA AVENUE AND WINNERS CIRCLECYPRESS, CA 90720SHEA PROPERTIESM.E.A.T.M.E.17JUN2019AS SHOWN2217.0014L0002217.0014L000_SITE VICINITY.DWG\\SRVLACAFP1\LA SHARED\CLIENTS\SHEA PROPERTIES\CYPRESS\PHASE I\05 - WORKABLES\02 - FIGURES\CAD\2217.0014L000_SITE VICINITY.DWG Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX TABLES 1. Soil Analytical Results Table 1. Soil Analytical ResultsNorthwest Corner, Katella Ave and Winners CircleCypress, CaliforniaSample ID Sample Date Antimony Arsenic Barium Cadmium Chromium Cobalt Copper Lead Molybdenum Nickel Vanadium Zinc TPH (C23-C44)USEPA Method 8015MUnits31 0.68 15,000 71 NS 23 3,100 400 390 NS 390 23,000NSNS 0.11 NS 71 NS NS NS 80 NS 820 NS NSNS11 0.26 15,000 78 NS 23 3,100 80 390 820 390 23,000 12,000SS-1-0.5 6/7/20193.83 3.56 77.60.76 20.5 10.8 14.4 11.0 6.11 13.6 45.0 57.2NASS-2-0.5 6/7/2019 <34.34 68.0 0.73 18.7 9.84 12.6 11.8 2.16 13.2 39.6 55.273SS-3-0.5 6/7/2019 <37.06 64.80.50 11.0 5.77 12.7 13.4<113.3 30.2 53.6NASS-4-0.5 6/7/2019 <37.55 77.80.68 19.5 9.45 14.4 17.2<113.7 39.7 56.0NASS-5-0.5 6/7/2019 <311.7 75.30.65 17.4 9.2 15.1 15.2<113.2 39.6 64.5NASS-6-0.5 6/7/2019 <37.30 88.50.82 20.8 10.8 16.6 16.3<114.4 42.1 72.8NASS-7-0.5 6/7/2019 <37.26 1050.83 22.3 11.8 17.9 16.3<115.3 48.0 67.7NASS-8-0.5 6/7/20193.43 2.99 87.10.73 21.4 11.4 14.8 9.6<113.4 46.9 58.5NANotes:USEPA = United States Environmental Protection Agencymg/kg = milligrams per kilogramaUpper-bound background concentration from Chernoff, G., Bosan, W., and Outiz, D., DTSC. Determination of a Southern California Regional Background Arsenic Concentration in Soil.RSL = USEPA Regional Screening Level for residential soil, updated May 2018.NS = No standard currently established. NA = Not analyzed.-- = Not applicable.<X = Analyte not detected at or above the laboratory Reporting Detection Limit.Bold indicates a concentration greater than the laboratory Reporting Detection Limit.Shaded indicates a concentration greater than the USEPA, DTSC HERO Note 3, and/or SF-RWQCB screening levels.Only analytes with detections are presented here. For full list of analytes, see laboratory reports.USEPA Method 6010B9-509 mean = 5712.4-97.1 mean = 23.923-1,579 mean = 122Analytical Methodmg/kg--12aTypical Range for California Soil10.05-1.7 mean = 0.36133-1,400 mean = 5090.15-1.95 mean = 0.602.7-46.9 mean = 14.99.1-96.4 mean = 28.70.1-9.6 mean = 1.3SF-RWQCB ESL = San Francisco Bay Regional Water Quality Control Board (SWBRWQCB) Environmental Screening level Direct Exposure Human Health Risk Level for Residential Shallow Soil Exposure. The most conservative values were chosen from the cancer and noncancer endpoint screening levels (i.e., the lowest screening level is shown here).USEPA RSL - Residential SoilSF-RWQCB ESL - Residential Soil39-288 mean = 11288-236 mean = 149DTSC HERO Note 3 SL = Residential soil screening level (SL) published by the California Department Of Toxic Substances Control (DTSC) Human And Ecological Risk Office (HERO) in Note Number 3, updated April 2019. The most conservative values were chosen from the cancer and noncancer endpoint screening levels (i.e., the lowest screening level is shown here).1Bradford, G.R., Chang, A.C., Page, A.L., Bakhtar, D., Frampton, J.A., and Wright, H., 1996, Background Concentrations of Trace and Major Elements in California Soils, Kearney Foundation of Soil Sciences Special Report, Division of Agriculture and Natural Resources, University of California.DTSC HERO Note 3 SL - Residential SoilROUX ASSOCIATES, INC.Page 1 of 1 2217.0014L.100/WKB Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDICES A. User-Provided Information B. Glossary of Terms C. Historical Topographic Maps D. EDR Radius Map Report with Geocheck® E. Previous Phase I ESA F. Historical Aerial Photographs G. City Directories H. Sanborn Fire Maps I. Regulatory Records Documentation J. Photographic Log K. Laboratory Report L. Personnel Qualifications Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX A User-Provided Information CBCBCBCBCBCBCBCB ELELEL CBCBCBCBCBCBCBCBCBCBELELCBCBCBCBLVELLV ELLV ELLV ELEL ELELCBCBELUP18R ELELLVEL UP18REL ELELELELLVELELEL LVEL ELELELELELELLVELELELEL EL ELELCBCB ELELEL 86'-2"49'-4"87'-8"83'-8" 9' 42'-1"83'-8"37'-2"150' FIRE HOSE PULL150' FIRE HOSE PULL26'-6"ENTRYDRIVE10' 15'TRASH ACCESS150'-0"LEASINGAMENITIESAMENITIESCOURTYARDCOURTYARDPASSAGEPASSAGE PASSAGE PASSAGE PASSAGE PASSAGE PASSAGE UTIL. RMPASSAGEUTIL. RMUTIL. RMCALLBOXGATEKATELLA AVE.WINNER'S CIR. SIBONEY ST.25'28'5'10'34'-10"575128 KEY(4 LEVELS)HOTEL5,000 SF6,000 SFSHOPS 27,000 SFSHOPS 128'SHOPS 360'-0"84'-0"PATIOPLAZA60'-0"84'-0" 104'-0"40'-0"30'-0"120'-0"60'-0"100'-0"38'-6"30'-0"20'41'-5"24'16' 7'-8"17'-6" 25'-8"22'-5"12'24' 24' 30'26'-3"28'24'24'24'24'24'14'-1"18'18'-8"R25'R25'R25'LOADINGLOADING43,175 SF(842 SEATS)MOVIE THEATER28'28'-1"25'-5"10'8' 20'28'28'8'9'-1"30'14'-1"R 2 5 'SHEA PROPERTIES130 Vantis, Ste. 200, Aliso Viejo, CA 92656(949) 389-7200144 NORTH ORANGE ST., ORANGE, CA 92866(714) 639-9860ARCHITECTS ORANGEARCHITECTSORANGECYPRESS MIXED-USE DEVELOPMENTCYPRESS, CADATE: 05-06-19JOB NO.: 2018-344A1.0OVERALL SITE PLANNORTH1"=40'-0"40'80'120'020'OPTION 1 $670(8VHU4XHVWLRQQDLUH  ,QRUGHUWRTXDOLI\IRUWKHSURWHFWLRQRIIHUHGXQGHUWKH(3$$OO$SSURSULDWH,QTXLU\ $$, 6WDQGDUGWKH8VHU HQWLWLHVVHHNLQJ WR XVHWKH$670( 3UDFWLFHWRFRPSOHWH DQHQYLURQPHQWDO VLWH DVVHVVPHQW RIWKHSURSHUW\ LH /HQGHUVDQGRU %RUURZHUV PXVWSURYLGHWKHIROORZLQJLQIRUPDWLRQ LIDYDLODEOH WRWKHHQYLURQPHQWDOSURIHVVLRQDO)DLOXUHWRSURYLGHWKLV LQIRUPDWLRQFRXOGUHVXOWLQDGHWHUPLQDWLRQWKDW$$,LVQRWFRPSOHWH7KLVLQIRUPDWLRQVKRXOGEHWKHFROOHFWLYHNQRZOHGJHRI WKHHQWLWLHVUHO\LQJRQWKH3KDVH,3OHDVHQRWHWKDW\RXDUHQRWEHLQJDVNHGWRHYDOXDWHWKHSURSHUW\EXWUDWKHUWRSURYLGH \RXUNQRZOHGJHRILQIRUPDWLRQRQWKHSURSHUW\  6LWH1DPH$GGUHVVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB   3HUVRQ,QWHUYLHZHG7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBBBBBBBBBBBBB  ,INQRZQZKHQZDVWKHSURSHUW\LQLWLDOO\GHYHORSHG"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  ,IGLIIHUHQWZKHQZHUHWKHFXUUHQWEXLOGLQJ V RQWKHSURSHUW\FRQVWUXFWHG"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB   (QYLURQPHQWDOFOHDQXSOLHQVWKDWDUHILOHGRUUHFRUGHGDJDLQVWWKHVLWH &)5   'LGDVHDUFKRIUHFRUGHGODQGWLWOHUHFRUGV RUMXGLFLDOUHFRUGVZKHUHDSSURSULDWHVHHQRWHEHORZ LGHQWLI\DQ\HQYLURQPHQWDO OLHQVILOHGRUUHFRUGHGDJDLQVWWKHSURSHUW\XQGHUIHGHUDOWULEDOVWDWHRUORFDOODZ"  <HVBBB 1RBBB,I\RXDQVZHU\HVSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZ  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  $FWLYLW\DQGODQGXVHOLPLWDWLRQVWKDWDUHLQSODFHRQWKHSURSHUW\RUWKDWKDYH EHHQILOHGRUUHFRUGHGLQDUHJLVWU\ &)5    'LGDVHDUFKRIUHFRUGHGODQGWLWOHUHFRUGV RUMXGLFLDOUHFRUGVZKHUHDSSURSULDWHVHHQRWHEHORZ LGHQWLI\$8/VVXFKDV HQJLQHHULQJFRQWUROVODQGXVHUHVWULFWLRQVRULQVWLWXWLRQDOFRQWUROVWKDWDUHLQSODFHDWWKH SURSHUW\DQGRUKDYHEHHQILOHG DJDLQVWWKHSURSHUW\XQGHUIHGHUDOWULEDOVWDWHRUORFDOODZ"  (QJLQHHULQJ&RQWUROVDUHGHILQHGDVSK\VLFDOPRGLILFDWLRQVWRDVLWHRUIDFLOLW\WRUHGXFHRUHOLPLQDWHWKHSRWHQWLDOIRUH[SRVXUH WRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVLQWKHVRLORUJURXQGZDWHURQWKHSURSHUW\ ,QVWLWXWLRQDO&RQWUROVDUHGHILQHG DVDOHJDORU DGPLQLVWUDWLYHUHVWULFWLRQRQWKHXVHRIRUDFFHVVWRDVLWHRUIDFLOLW\ WR UHGXFHRUHOLPLQDWHWKHSRWHQWLDOIRU H[SRVXUHWRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVLQWKHVRLORUJURXQGZDWHURQWKHSURSHUW\RU WRSUHYHQWDFWLYLWLHV WKDWFRXOGLQWHUIHUHZLWKWKHHIIHFWLYHQHVVRIDUHVSRQVHDFWLRQLQRUGHUWRHQVXUHPDLQWHQDQFHRIDFRQGLWLRQRIQRVLJQLILFDQW ULVNWRSXEOLFKHDOWKRUWKHHQYLURQPHQW  <HVBBB 1RBBB,I\RXDQVZHU\HVSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZ  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB   1RWH,QFHUWDLQMXULVGLFWLRQVIHGHUDOWULEDOVWDWHRUORFDOVWDWXWHVRUUHJXODWLRQVVSHFLI\WKDWHQYLURQPHQWDOOLHQVDQG$8/V EHILOHGLQMXGLFLDOUHFRUGVUDWKHUWKDQODQGWLWOHUHFRUGV,QVXFKFDVHVMXGLFLDOUHFRUGVPXVWEHVHDUFKHGIRUHQYLURQPHQWDOOLHQV DQG$8/V Northwest corner of Katella Ave. and Winners Circle Elizabeth Cobb - VP of Development 5/8/19 Unknown No building on-site X X 6SHFLDOL]HGNQRZOHGJHRUH[SHULHQFHRIWKHSHUVRQVHHNLQJWRTXDOLI\IRUWKH//3 &)5  'R\RXKDYHDQ\VSHFLDOL]HGNQRZOHGJHRUH[SHULHQFHUHODWHGWRWKHSURSHUW\RUQHDUE\SURSHUWLHV" )RUH[DPSOHDUH\RXLQYROYHGLQWKHVDPHOLQHRIEXVLQHVVDVWKHFXUUHQWRUIRUPHURFFXSDQWVRIWKHSURSHUW\RUDQDGMRLQLQJ SURSHUW\VRWKDW\RXZRXOGKDYHVSHFLDOL]HGNQRZOHGJHRIWKHFKHPLFDOVDQGSURFHVVHVXVHGE\WKLVW\SHRIEXVLQHVV"  <HVBBB 1RBBB,I\RXDQVZHU\HVSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZ  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  5HODWLRQVKLSRIWKHSXUFKDVHSULFHWRWKHIDLUPDUNHWYDOXHRIWKHSURSHUW\LILWZHUHQRWFRQWDPLQDWHG &)5   D 'RHVWKHSXUFKDVHSULFHEHLQJSDLGIRUWKLVSURSHUW\UHDVRQDEO\UHIOHFWWKHIDLUPDUNHWYDOXHRIWKHSURSHUW\"  <HVBBB 1RBBB,I\RXDQVZHUQRSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZLQFOXGLQJZKHWKHUWKHORZHU SXUFKDVHSULFHLVEHFDXVHFRQWDPLQDWLRQLVNQRZQRUEHOLHYHGWREHSUHVHQWDWWKHSURSHUW\"  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  &RPPRQO\NQRZQRUUHDVRQDEO\DVFHUWDLQDEOHLQIRUPDWLRQDERXWWKHSURSHUW\ &)5   $UH \RX DZDUHRIFRPPRQO\ NQRZQ RUUHDVRQDEO\ DVFHUWDLQDEOHLQIRUPDWLRQ DERXWWKHSURSHUW\WKDW ZRXOGKHOSWKH HQYLURQPHQWDOSURIHVVLRQDOWRLGHQWLI\FRQGLWLRQVLQGLFDWLYHRIUHOHDVHVRUWKUHDWHQHGUHOHDVHV")RUH[DPSOHDV8VHU   D'R\RXNQRZWKHSDVWXVHVRIWKHSURSHUW\"   <HVBBB1RBBB   E'R\RXNQRZRIVSHFLILFFKHPLFDOVWKDWDUHSUHVHQWRURQFHZHUHSUHVHQWDWWKHSURSHUW\"  <HVBBB1RBBB   F'R\RXNQRZRIVSLOOVRURWKHUFKHPLFDOUHOHDVHVWKDWKDYHWDNHQSODFHDWWKHSURSHUW\"   <HVBBB1RBBB   G'R\RXNQRZRIDQ\HQYLURQPHQWDOFOHDQXSVWKDWKDYHWDNHQSODFHDWWKHSURSHUW\"   <HVBBB1RBBB   ,I\RXDQVZHUHG\HVWRDQ\RIWKHTXHVWLRQVDERYHSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB X X X X X X 7KHGHJUHHRIREYLRXVQHVVRIWKHSUHVHQFH RIOLNHO\SUHVHQFHRIFRQWDPLQDWLRQDWWKHSURSHUW\DQGWKHDELOLW\WRGHWHFWWKH FRQWDPLQDWLRQE\DSSURSULDWHLQYHVWLJDWLRQ &)5   %DVHGRQ\RXUNQRZOHGJHDQGH[SHULHQFHUHODWHGWRWKHSURSHUW\DUHWKHUHDQ\REYLRXVLQGLFDWRUVWKDW SRLQWWRWKHSUHVHQFHRUOLNHO\SUHVHQFHRIFRQWDPLQDWLRQDWWKHSURSHUW\"  <HVBBB 1RBBB,I\RXDQVZHU\HVSOHDVHLQFOXGHDQH[SODQDWLRQLQWKHVSDFHSURYLGHGEHORZ  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  3OHDVHSURYLGHWKHIROORZLQJSURSHUW\FRQWDFWLQIRUPDWLRQ  3URSHUW\2ZQHUBBBBBBBBBBBBBBBBBBBBBBBB  3KRQH1XPEHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  .H\6LWH3HUVRQQHOBBBBBBBBBBBBBBBBBBBBBB  3KRQH1XPEHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  3DVW2ZQHUBBBBBBBBBBBBBBBBBBBBBBBBBBBB  3KRQH1XPEHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBB X City of Cypress (714) 229-6700 Dr. Allred Unknown Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX B Glossary of Terms 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 1 GLOSSARY OF KEY TERMS This appendix provides definitions, description of terms, and a list of acronyms for many of the words used in ASTM E 1527-13. These terms are an integral part of ASTM E 1527-13 and are critical to understanding ASTM E 1527-13 and its use. DEFINITIONS: Abandoned Property – property that can be presumed to be deserted, or an intent to relinquish possession or control can be inferred from the general disrepair or lack of activity thereon such that a reasonable person could believe that there was an intent on the part of the current owner to surrender rights to the property. Activity and Use Limitations – Legal or physical restrictions or limitations on the use of, or access to, a site or facility: (1) to reduce or eliminate potential exposure to hazardous substances or petroleum products in the soil, soil vapor, groundwater, and/or surface water on the property, or (2) to prevent activities that could interfere with the effectiveness of a response action, in order to ensure maintenance of a condition of no significant risk to public health or the environment. These legal or physical restrictions, which may include institutional and/or engineering controls, are intended to prevent adverse impacts to individuals or populations that may be exposed to hazardous substances and petroleum products in the soil, soil vapor, groundwater, and/or surface water on the property. Comprehensive Environmental Response, Compensation, and Liability Information System (CERCLIS) – The list of sites compiled by EPA that EPA has investigated, or is currently investigating, for potential hazardous substance contamination for possible inclusion on the National Priorities List. Construction debris – Concrete, brick, asphalt, and other such building materials discarded in the construction of a building or other improvement to property. Contaminated public wells – Public wells used for drinking water that have been designated by a government entity as contaminated by toxic substances (for example, chlorinated solvents), or as having water unsafe to drink without treatment. Contiguous Property Owner Liability Protection – a person may qualify for the contiguous property owner liability protection if, among other requirements, such person owns real property that is contiguous to, and that is or may be contaminated by hazardous substances from other real property that is not owned by that person. Furthermore, such person conducted all appropriate inquiries at the time of acquisition of the property and did not know or have reason to know that the property was or could be contaminated by a release or threatened release from the contiguous property. The all appropriate inquiries must not result in knowledge of contamination. If it does, then such person did “know” or “had reason to know” of contamination and would not be eligible for the contiguous property owner liability protection. Controlled Recognized Environmental Condition – a recognized environmental condition resulting from a past release of hazardous substances or petroleum products that has been addressed to the satisfaction of the applicable regulatory authority (for example, as evidenced by the issuance of a no further action letter or equivalent, or meeting risk-based criteria established by regulatory authority), with hazardous substances or petroleum products allowed to remain in place subject to the implementation of required controls (for example, property use restrictions, activity and use limitations, institutional controls, or engineering controls). CORRACTS list – a list maintained by EPA of hazardous waste treatment, storage, or disposal facilities and other RCRA-regulated facilities (due to past interim status or storage of hazardous waste beyond 90 days) 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 2 that have been notified by the U.S. Environmental Protection Agency to undertake corrective action under RCRA. The CORRACTS list is a subset of the EPA database that manages RCRA data. Demolition debris – Concrete, brick, asphalt, and other such building materials discarded in the demolition of a building or other improvement to property. Drum – A container (typically, but not necessarily, holding 55 gal (208 L) of liquid) that may be used to store hazardous substances or petroleum products. Dry wells – Underground areas where soil have been removed and replaced with pea gravel, coarse sand, or large rocks. Dry wells are used for drainage, to control storm runoff, for the collection of spilled liquids (intentional and non-intentional), and wastewater disposal (often illegal). Dwelling – Structure of portion thereof used for residential habitation. Engineering controls – Physical modifications to a site or facility (for example, capping, slurry walls, or point of use water treatment) to reduce or eliminate the potential for exposure to contaminants in the soil or groundwater on the property. Environmental lien – A charge, security, or encumbrance upon title to a property to secure the payment of a cost, damage, debt, obligation, or duty arising out of response actions, cleanup, or other remediation of hazardous substances or petroleum products upon a property, including (but not limited to) liens imposed pursuant to CERCLA 42 USC § 9607(1) and similar state or local laws. ERNS list – EPA’s emergency response notification system list of reported CERCLA hazardous substance releases or spills in quantities greater than the reportable quantity, as maintained at the National Response Center. Notification requirements for such releases or spills are codified in 40 CFR parts 302 and 355. Federal Register (FR) – Publication of the Untied States government published daily (except for federal holidays and weekends) containing all proposed and final regulations and some other activities of the federal government. When regulations become final, they are included in the Code of Federal Regulations (CFR), as well as published in the Federal Register. Fire insurance maps – Maps produced for private fire insurance map companies that indicate uses of properties at specified dates and that encompass the property. These maps are often available in local libraries, historical societies, private resellers, or from the map companies who produced them. See Question 23 of the transaction screen process in Practice E 1528 and 7.3.4.2 of this practice. Hazardous substance – A substance defined as hazardous pursuant to CERCLA 42 USC § 9601(14), as interpreted by EPA regulations and the courts: “(A) any substance designated pursuant to section 1321(b)(2)(A) of Title 33, (B) any element, compound, mixture, solution, or substance designated pursuant to section 9602 of this title, (C) any hazardous waste having the characteristics identified under or listed pursuant to section 3001 of the Soil Waste Disposal Act (42 USC § 6921) (but not including any waste the regulation of which under the Solid Waste Disposal Act (42 USC § 6901 et seq.) has been suspended by Act of Congress), (D) any toxic pollutant listed under section 1317(a) of Title 33, (E) any hazardous air pollutant listed under section 112 of the Clean Air Act (42 USC § 7412), and (F) any imminently hazardous chemical substance or mixture with respect to which the Administrator (of EPA) has taken action pursuant to section 2606 of Title 15. The term does not include petroleum, including crude oil or any fraction thereof, which is not otherwise specifically listed or designated as a hazardous substance under subparagraphs (A) 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 3 through (F) of this paragraph; the term does not include natural gas, natural gas liquids, liquefied natural gas, or synthetic gas usable for fuel (or mixtures of natural gas and such synthetic gas).” Hazardous waste – Any hazardous waste having the characteristics identified under or listed pursuant to section 3001 of the Solid Waste Disposal Cat (42 USC § 6921) (but not including any waste the regulation of which under the Solid Waste Disposal Act (42 USC § 6901 et seq.) has been suspended by Act of Congress). The Solid Waste Disposal Act of 1980 amended RCRA. RCRA defines hazardous waste, in 42 USC § 6903, as: “a solid waste, or combination of solid wastes, which because of its quantity, concentration, or physical, chemical, or infectious characteristics may – (A) cause, or significantly contribute to an increase in mortality or an increase in serious irreversible, or incapacitating reversible, illness; or (B) pose a substantial present or potential hazard to human health or the environment when improperly treated, stored, transported, or disposed of, or otherwise managed.” Institutional control – A legal or administrative restriction (e.g., deed restriction, restrictive zoning) on the use of, or access to, a site or facility to reduce or eliminate potential exposure to contaminants in the soil or groundwater on the property. Landfill – A place, location, tract of land, area, or premises used for the disposal of solid wastes as defined by state solid waste regulations. The term is synonymous with the term solid waste disposal site and is also known as a garbage dump, trash dump, or similar term. Local street directories – Directories published by private (or sometimes government) sources that show ownership, occupancy, and/or use of sites by reference to street addresses. Often, local street directories are available at libraries of local governments, colleges or universities, or historical societies. Material safety data sheet (MSDS) – Written or printed material concerning a hazardous substance which is prepared by chemical manufacturers, importers, and employers for hazardous chemicals pursuant to OSHA’s Hazard Communication Standard, 29, CFR 1910.1200. National Contingency Plan (NCP) – The National Oil and Hazardous Substances Pollution Contingency Plan, found at 40 CFR § 300, that is the EPA’s blueprint on how hazardous substances are to be cleaned up pursuant to CERCLA. National Priorities List (NPL) – List compiled by the EPA, pursuant to CERCLA 42 USC § 9605(a)(8)(B), of properties with the highest priority for cleanup pursuant to EPA’s Hazard Ranking System. See 40 CFR Part 300. Occupants – Those tenants, subtenants, or other persons or entities using the property or a portion of the property. Owner – Generally the fee owner of record for the property. Petroleum exclusion – The exclusion from CERCLA liability provided in 42 USC § 9601(14), as interpreted by the courts and EPA: “The term (hazardous substance) does not include petroleum, including crude oil or any fraction thereof which is not otherwise specifically listed or designated as a hazardous substance under subparagraphs (A) through (F) of this paragraph, and the term does not include natural gas, natural gas liquids, liquefied natural gas, or synthetic gas usable for fuel (or mixtures of natural gas and such synthetic gas).” 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 4 Petroleum products – Those substances included within the meaning of the petroleum exclusion to CERCLA, 42 USC § 9601(14), as interpreted by the courts and EPA, that is: petroleum, including crude oil or any fraction thereof which is not otherwise specifically listed or designated as a hazardous substance under Subparagraphs (A) through (F) of 42 USC § 9601(14), natural gas, natural gas liquids, liquefied natural gas, and synthetic gas usable for fuel (or mixtures of natural gas and such synthetic gas). (The word fraction refers to certain distillates of crude oil, including gasoline, kerosene, diesel oil, jet fuels, and fuel oil, pursuant to Standard Definitions of Petroleum Statistics1.) Phase I Environmental Site Assessment – The process described in this practice. Pits, ponds, or lagoons – Man-made or natural depressions in the ground surface that are likely to hold liquids or sludge containing hazardous substances or petroleum products. The likelihood of such liquids or sludge being present is determined by evidence of factors associated with the pit, pond, or lagoon, including, but not limited to, discolored water, distressed vegetation, or the presence of an obvious wastewater discharge. Property – The real property that is the subject of the environmental site assessment described in this practice. Real property includes buildings and other fixtures and improvement located on the property and affixed to the land. Property tax files – The files kept for property tax purposes by the local jurisdiction where the property is located and includes records of past ownership, appraisals, maps, sketches, photos, or other information that is reasonable ascertainable and pertaining to the property. RCRA generators – Those persons or entities that generate hazardous waste, as defined and regulated by RCRA. RCRA generators list – List kept by the EPA of those persons or entities that generate hazardous wastes as defined and regulated by RCRA. RCRA TSD facilities – Those facilities at which treatment, storage, and/or disposal of hazardous wastes takes place, as defined and regulated by RCRA. RCRA TSD facilities list – List kept by the EPA of those facilities at which treatment, storage, and/or disposal of hazardous wastes takes place, as defined and regulated by RCRA. Recorded land title records – Records of fee ownership, leases, land contracts, easements, liens, and other encumbrances on or of the property recorded in the place where land title records are, by law or custom, recorded for the local jurisdiction in which the property is located. (Often such records are kept by a municipal or county recorder or clerk.) Such records may be obtained from title companies or directly from the local government agency. Information about the title to the property that is recorded in a U.S. district court or any place other than where land title records are, by law or custom, recorded for the local jurisdiction in which the property is located, are not considered part of recorded land title records. Records of emergency release notifications (SARA § 304) – Section 304 of EPCRA or Title III of SARA requires operators of facilities to notify their local emergency planning committee (as defined in EPCRA) and the state emergency response commission (as defined in EPCRA) of any release beyond the facility’s boundary of any reportable quantity of any extremely hazardous substance. Often the local fire department is the local emergency planning committee. Records of such notifications are “Records of Emergency Release Notifications” (SARA§ 304). 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 5 Report – The written record of a transaction screen process as required by Practice E 1528 or the written report prepared by the environmental professional and constituting part of a “Phase I Environmental Site Assessment,” as required by this practice. Solid waste disposal site – A place, location, tract of land, area, or premises used for the disposal of solid wastes as defined by state solid waste regulations. The term is synonymous with the term landfill and is also known as a garbage dump, trash dump, or similar term. Solvent – A chemical compound that is capable of dissolving another substance and may itself be a hazardous substance, used in a number of manufacturing/industrial processes including, but not limited to, the manufacture of paints and coatings for industrial and household purposes, equipment clean-up, and surface degreasing in metal fabricating industries. State registered USTs – State lists of underground storage tanks required to be registered under Subtitle I, Section 9002 of RCRA. Sump – A pit, cistern, cesspool, or similar receptacle where liquids drain, collect, or are stored. TSD facility – Treatment, storage, or disposal facility (see RCRA TSD facilities). Underground storage tank (UST) - Any tank, including underground piping connected to the tank, that is or has been used to contain hazardous substances or petroleum products and the volume of which is 10% or more beneath the surface of the ground. USGS 7.5 Minute Topographic Map – The map (if any) available from or produced by the United States Geological Survey, entitled “USGS 7.5 Minute Topographic Map,” and showing the property. Wastewater – Water that (1) is or has been used in an industrial or manufacturing process, (2) conveys or has conveyed sewage, or (3) is directly related to manufacturing, processing, or raw materials storage areas at an industrial plant. Wastewater does not include water originating on or passing through or adjacent to a site, such as storm water flows, that has not been used in industrial or manufacturing processes, has not been combined with sewage, or is not directly related to manufacturing, processing, or raw materials storage areas at an industrial plant. Zoning/land use records – Those records of the local government in which the property is located, indicating the uses permitted by the local government in particular zones within its jurisdiction. The records may consist of maps and/or written records. They are often located in the planning department of a municipality or county. DEFINITIONS SPECIFIC TO ASTM E 1527-13: Actual knowledge – The knowledge actually possessed by an individual who is a real person, rather than an entity. Actual knowledge is to be distinguished from constructive knowledge that is knowledge imputed to an individual or entity. Adjoining properties – Any real property or properties the border of which is contiguous or partially contiguous with that of the property, or that would be contiguous or partially contiguous with that of the property but for a street, road, or other public thoroughfare separating them. 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 6 Aerial photographs – Photographs taken from an airplane or helicopter (from a low enough altitude to allow identification of development and activities) of areas encompassing the property. Aerial photographs are often available from government agencies or private collections unique to a local area. Appropriate inquiry – That inquiry constituting “all appropriate inquiry into the previous ownership and uses of the property consistent with good commercial or customary practice” as defined in CERCLA, 42 USC § 9601(35)(B), that will give a party to a commercial real estate transaction the innocent landowner defense to the CERCLA liability (42 USC § 9601(A) and (B) and § 9607(b)(3)), assuming compliance with other elements of the defense. See Appendix X1. Approximate minimum search distance – The area for which records must be obtained and reviewed pursuant to Section 7 subject to the limitations provided in that section. This may include areas outside the property and shall be measured from the nearest property boundary. This term is used in lieu of radius to include irregularly-shaped properties. Building department records – Those records of the local government in which the property is located indicating permission of the local government to construct, alter, or demolish improvements on the property. Often, building department records are located in the building department of a municipality or county. Business environmental risk – A risk which can have a material environmental or environmentally-driven financial impact on the business associated with the current or planned use of a parcel of commercial real estate, not necessarily limited to those environmental issues required to be investigated in this practice. Consideration of business environmental risk issues may necessitate that an environmental professional address one or more non-scope considerations, some of which are identified in Section 12. Commercial real estate – Any real property except a dwelling or property with no more than four dwelling units exclusively for residential use (except that a dwelling or property with no more than four dwelling units exclusively for residential use is included in this term when it has a commercial function, as in the building of such dwellings for profit). This term includes, but is not limited to, undeveloped real property and real property used for industrial, retail, office, agricultural, other commercial, medical, or educational purposes; property used for residential purposes that has more than four residential dwelling units; and any property with no more than four dwelling units for residential use when it has a commercial function, as in the building of such dwellings for profit. Commercial real estate transaction – A transfer of title to or possession of real property or receipt of a security interest in real property, except that it does not include transfer of title to or possession of real property or the receipt of a security interest in real property with respect to an individual dwelling or building containing fewer than five dwelling units, nor does it include the purchase of a lot or lots to construct a dwelling for occupancy by a purchaser, but a commercial real estate transaction does include real property purchased or leased by persons or entities in the business of building or developing dwelling units. Controlled Recognized Environmental Condition – a recognized environmental condition resulting from a past release of hazardous substances or petroleum products that has been addressed to the satisfaction of the applicable regulatory authority (for example, as evidenced by the issuance of a no further action letter or equivalent, or meeting risk-based criteria established by regulatory authority), with hazardous substances or petroleum products allowed to remain in place subject to the implementation of required controls (for example, property use restrictions, activity and use limitations, institutional controls, or engineering controls). 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 7 Due diligence – The process of inquiring into the environmental characteristics of a parcel of commercial real estate or other conditions, usually in connection with a commercial real estate transaction. The degree and kind of due diligence vary for different properties and differing purposes. Environmental audit – The investigative process to determine if the operations of an existing facility are in compliance with applicable environmental laws and regulations. This term should not be used to describe Practice E 1528 or this practice, although an environmental audit may include an environmental site assessment or, if prior audits are available, may be part of an environmental site assessment. Environmental professional – A person processing sufficient training and experience necessary to conduct a site reconnaissance, interviews, and other activities in accordance with this practice, and from the information generated by such activities, having the ability to develop opinions and conclusions regarding recognized environmental conditions in connection with the property in question. An individual’s status as an environmental professional may be limited to the type of assessment to be performed or to specific segments of the assessment for which the professional is responsible. The person may be an independent contractor or an employee of the user. Environmental site assessment (ESA) – The process by which a person or entity seeks to determine if a particular parcel of real property (including improvements) is subject to recognized environmental conditions. At the option of the user, an environmental site assessment may include more inquiry than that constituting appropriate inquiry or, if the user is not concerned about qualifying for the innocent landowner defense, less inquiry than that constituting appropriate inquiry. An environmental site assessment is both different from and less rigorous than an environmental audit. Fill dirt – Dirt, soil, sand, or other earth, obtained off-site, that is used to fill holes or depressions, create mounds, or otherwise artificially change the grade or elevation of real property. It does not include material that is used in limited quantities for normal landscaping activities. Hazardous waste/contaminated sites – Sites on which a release has occurred, or is suspected to have occurred, of any hazardous substance, hazardous waste, or petroleum products, and that release or suspected release has been reported to a government entity. Historical Recognized Environmental Condition – a past release of any hazardous substances or petroleum products that has occurred in connection with the property and has been addressed to the satisfaction of the applicable regulatory authority or meeting unrestricted use criteria established by a regulatory authority, without subjecting the property to any required controls (for example, property use restrictions, activity and use limitations, institutional controls, or engineering controls). Before calling the past release a historical recognized environmental condition, the environmental professional must determine whether the past release is a recognized environmental condition at the time the Phase I Environmental Site Assessment is conducted (for example, if there has been a change in the regulatory criteria). If the EP considers the past release to be a recognized environmental condition at the time the Phase I ESA is conducted, the condition shall be included in the conclusions section of the report as a recognized environmental condition. Innocent landowner defense – That defense to CERCLA liability provided in 42 USC § 9601(35) and § 9607(b)(3). One of the requirements to qualify for this defense is that the party make “all appropriate inquiry into the previous ownership and uses of the property consistent with good commercial or customary practice.” There are additional requirements to qualify for this defense. 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 8 Interviews – Those portions of this practice that are contained in Section 9 and 10 thereof and address questions to be asked of owners and occupants of the property and questions to be asked of local government officials. Key site manager – The person identified by the owner of a property as having good knowledge of the uses and physical characteristics of the property. Local government agencies – Those agencies of municipal or county government having jurisdiction over the property. Municipal and county government agencies include, but are not limited to, cities, parishes, townships, and similar entities. LUST sites – State lists of leaking underground storage tank sites. Section 9003 (h) of Subtitle I of RCRA gives EPA and states, under cooperative agreements with EPA, authority to clean up releases from UST systems or require owners and operators to do so. Major occupants – Those tenants, subtenants, or other persons or entities each of which uses at least 40% of the leasable area of the property or any anchor tenant when the property is a shopping center. Material threat – A physically observable or obvious threat which is reasonable likely to lead to a release that, in the opinion of the environmental professional, is threatening and might result in impact to human health and the environment. An example might include an aboveground storage tank that contains a hazardous substance and which shows evidence of damage. The damage would represent a material threat if it is deemed serious enough that it may cause or contribute to tank integrity failure with a release of contents to the environment. Obvious – That which is plain or evident; a condition or fact that could not be ignored or overlooked by a reasonable observer while visually or physically observing the property. Other historical sources – Any source or sources other than those designated in 7.3.4.1-7.3.4.8 that are credible to a reasonable person and that identify past uses of the property. The term includes, but is not limited to, miscellaneous maps, newspaper archives, and records in the files and/or personal knowledge of the property owner and/or occupants. Physical setting sources – sources that provide information about the geologic, hydrogeologic, hydrologic, or topographic characteristics of a property. Practically reviewable – Information that is practically reviewable means that the information is provided by the source in a manner and in a form that, upon examination, yields information relevant to the property without the need for extraordinary analysis of irrelevant data. The form of the information shall be such that the user can review the records for a limited geographic area. Records that cannot be feasibly retrieved by reference to the location of the property or a geographic area in which the property is located are not generally practically reviewable. Most databases of public records are practically reviewable if they can be obtained from the source agency by the county, city, zip code, or other geographic area of the facilities listed in the record system. Records that are sorted, filed, organized, or maintained by the source agency only chronologically are not generally practically reviewable. Listings in publicly available records which do not have adequate address information to be located geographically are not generally considered practically reviewable. For large databases with numerous facility records (such as RCRA hazardous waste generators and registered underground storage tanks), the records are not practically reviewable unless they can be obtained from the source agency in the smaller geographic area of zip codes. Even when information is provided by zip code for some large databases, it is common for an unmanageable number of sites to be 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 9 identified within a given zip code. In these cases, it is not necessary to review the impact of all of the sites that are likely to be listed in any given zip code because that information would not be practically reviewable. In other words, then so much data is generated that it cannot be feasibly reviewed for its impact on the property, it is not practically reviewable. Preparer – The person preparing the transaction screen questionnaire pursuant to Practice E 1528, who may be either the user or the person to whom the user has delegated the preparation of the transaction screen questionnaire. Publicly available – Information that is publicly available means that the source of the information allows access to the information by anyone upon request. Reasonably ascertainable – For purposes of both this practice and Practice E 1528, information that is (1) publicly available, (2) obtainable from its source within reasonable time and cost constraints, and (3) practically reviewable. Recognized Environmental Conditions – the presence or likely presence of any hazardous substances or petroleum products in, on, or at a property: (1) due to release to the environment; (2) under conditions indicative of a release to the environment; or (3) under conditions that pose a material threat of a future release to the environment. De minimis conditions are not recognized environmental conditions. Records review – That part that is contained in Section 7 of this practice addresses which records shall or may be reviewed. Site reconnaissance – That part that is contained in Section 8 of this practice and addresses what should be done in connection with the site visit. The site reconnaissance includes, but is not limited to, the site visit done in connection with such a Phase I Environmental Site Assessment. Site visit – The visit to the property during which observations are made constituting the site reconnaissance section of this practice and the site visit requirement of Practice E 1528. Standard environmental record sources – Those records specified in 7.2.1.1. Standard historical sources – Those sources of information about the history of uses of the property specified in 7.3.4. Standard physical setting source – A current USGS 7.5-minute topographic map (if any) showing the area on which the property is located. Standard practice(s) – The activities set forth in either and both this practice and Practice E 1528. Standard sources – Sources of environmental, physical setting, or historical records specified in Section 7 of this practice. Transaction screen process – The process described in Practice E 1528. Transaction screen questionnaire – The questionnaire provided in Section 6 of Practice E 1528. User – The party seeking to use Practice E 1528 to perform an environmental site assessment of the property. A user may include, without limitation, a purchaser of property, a potential tenant of property, an owner of property, a lender, or a property manager. 2867.0002L.101/R. apps.docx Phase I Environmental Site Assessment | ROUX | 10 Visually and/or physically observed – During a site visit pursuant to Practice E 1528, or pursuant to this practice, this term means observations made by vision while walking through a property and the structures located on it and observations made by the sense of smell, particularly observations of noxious or foul odors. The term “walking through” is not meant to imply that disabled persons who cannot physically walk may not conduct a site visit; they may do so by the means at their disposal for moving through the property and the structures located on it. ACRONYMS: CERCLA – Comprehensive Environmental Response, Compensation and Liability Act of 1980 (as amended, 42 USC § 9601 et seq.) CERCLIS – Comprehensive Environmental Response, Compensation and Liability Information System (maintained by EPA) CFR – Code of Federal Regulations CORRACTS – Facilities subject to corrective action under RCRA EPA – United States Environmental Protection Agency EPCRA – Emergency Planning and Community Right to Know Act (also known as SARA Title III), 42 USC § 11001 et seq.) ERNS – Emergency response notification system ESA – Environmental site assessment (different than an environmental audit) FOIA – U.S. Freedom of Information Act (5 USC 552 et seq.) FR – Federal Register LUST – Leaking underground storage tank MSDS – Material safety data sheet NCP – National Contingency Plan Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX C Historical Topographic Maps EDR Historical Topo Map Report Inquiry Number: 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com with QuadMatch™ Not Reported Not Reported Los Alamitos, CA 90720 May 08, 2019 5646263.4 EDR Historical Topo Map Report EDR Inquiry # Search Results: P.O.# Project: Maps Provided: Disclaimer - Copyright and Trademark Notice EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. page- Coordinates: Latitude: Longitude: UTM Zone: UTM X Meters: UTM Y Meters: Elevation: Contact: Site Name: Client Name: 2012 1981 1972 1964 1950 1949 1947 1945 1943 1942 1935 1925 1923 1902 1899 1896 05/08/19 Not Reported Roux Associates Not Reported 402 Heron Drive Los Alamitos, CA 90720 Logan Township, NJ 08085-0000 5646263.4 Angela Truong EDR Topographic Map Library has been searched by EDR and maps covering the target property location as provided by Roux Associates were identified for the years listed below. EDR’s Historical Topo Map Report is designed to assist professionals in evaluating potential liability on a target property resulting from past activities. EDRs Historical Topo Map Report includes a search of a collection of public and private color historical topographic maps, dating back to the late 1800s. 2217.0014L000 33.804178 33° 48' 15" North Cypress -118.042085 -118° 2' 32" West Zone 11 North 403543.40 3740932.02 32.00' above sea level This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2019 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. 5646263 4 2 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 2012 Source Sheets 2012 Los Alamitos 7.5-minute, 24000 1981 Source Sheets 1981 Los Alamitos 7.5-minute, 24000 Aerial Photo Revised 1978 1972 Source Sheets 1972 Los Alamitos 7.5-minute, 24000 Aerial Photo Revised 1972 1964 Source Sheets 1964 Los Alamitos 7.5-minute, 24000 Aerial Photo Revised 1963 5646263 4 3 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1950 Source Sheets 1950 Los Alamitos 7.5-minute, 24000 Aerial Photo Revised 1947 1949 Source Sheets 1949 Los Alamitos 7.5-minute, 24000 Aerial Photo Revised 1947 1947 Source Sheets 1947 DOWNEY 15-minute, 50000 1945 Source Sheets 1945 Artesia 7.5-minute, 24000 5646263 4 4 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1943 Source Sheets 1943 Downey 15-minute, 62500 Aerial Photo Revised 1939 1942 Source Sheets 1942 Downey 15-minute, 62500 1935 Source Sheets 1935 Los Alamitos 7.5-minute, 31680 1925 Source Sheets 1925 Artesia 7.5-minute, 24000 5646263 4 5 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1923 Source Sheets 1923 Artesia 7.5-minute, 24000 1902 Source Sheets 1902 Downey 15-minute, 62500 1899 Source Sheets 1899 Downey 15-minute, 62500 1896 Source Sheets 1896 Downey 15-minute, 62500 5646263 4 6 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 2012 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 2012, 7.5-minute 5646263 4 7 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1981 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1981, 7.5-minute 5646263 4 8 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1972 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1972, 7.5-minute 5646263 4 9 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1964 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1964, 7.5-minute 5646263 4 10 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1950 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1950, 7.5-minute 5646263 4 11 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1949 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1949, 7.5-minute 5646263 4 12 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1947 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, DOWNEY, 1947, 15-minute 5646263 4 13 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1945 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Artesia, 1945, 7.5-minute 5646263 4 14 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1943 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Downey, 1943, 15-minute 5646263 4 15 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1942 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Downey, 1942, 15-minute 5646263 4 16 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1935 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Los Alamitos, 1935, 7.5-minute 5646263 4 17 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1925 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Artesia, 1925, 7.5-minute 5646263 4 18 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1923 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Artesia, 1923, 7.5-minute 5646263 4 19 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1902 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Downey, 1902, 15-minute 5646263 4 20 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1899 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Downey, 1899, 15-minute 5646263 4 21 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1896 0 Miles 0.25 0.5 1 1.5 Not Reported Not Reported Los Alamitos, CA 90720 Roux Associates TP, Downey, 1896, 15-minute 5646263 4 22 Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX D EDR Radius Map Report with GeoCheck® FORM-LBC-JBR ®kcehCoeG htiw tropeR ™paM suidaR RDE ehT 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com Not Reported Not Reported Los Alamitos, CA 90720 Inquiry Number: 5646263.2s May 08, 2019 SECTION PAGE Executive Summary ES1 Overview Map 2 Detail Map 3 Map Findings Summary 4 Map Findings 8 Orphan Summary 116 Government Records Searched/Data Currency Tracking GR-1 GEOCHECK ADDENDUM Physical Setting Source Addendum A-1 Physical Setting Source Summary A-2 Physical Setting SSURGO Soil Map A-6 Physical Setting Source Map A-11 Physical Setting Source Map Findings A-13 Physical Setting Source Records Searched PSGR-1 TC5646263.2s Page 1 Thank you for your business. Please contact EDR at 1-800-352-0050 with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2019 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. TABLE OF CONTENTS EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 1 A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR). The report was designed to assist parties seeking to meet the search requirements of EPA’s Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-13), the ASTM Standard Practice for Environmental Site Assessments for Forestland or Rural Property (E 2247-16), the ASTM Standard Practice for Limited Environmental Due Diligence: Transaction Screen Process (E 1528-14) or custom requirements developed for the evaluation of environmental risk associated with a parcel of real estate. TARGET PROPERTY INFORMATION ADDRESS NOT REPORTED LOS ALAMITOS, CA 90720 COORDINATES 33.8041780 - 33˚ 48’ 15.04’’Latitude (North): 118.0420850 - 118˚ 2’ 31.50’’Longitude (West): Zone 11Universal Tranverse Mercator: 403541.2UTM X (Meters): 3740738.2UTM Y (Meters): 32 ft. above sea levelElevation: USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 5633745 LOS ALAMITOS, CATarget Property Map: 2012Version Date: AERIAL PHOTOGRAPHY IN THIS REPORT 20140513Portions of Photo from: USDASource: 5646263.2s Page 2 H38 VESPER CORP 4411 KATELLA AV ENVIROSTOR, EMI, HAZNET, CIWQS Lower 3609, 0.684, West 37 R & D BLDG PARCEL 7 5730 KATELLA AVE ENVIROSTOR, HAZNET, CIWQS Higher 2241, 0.424, ESE 36 ORANGE COUNTY FIRE S 4991 CERRITOS LUST, SWEEPS UST, CA FID UST, HIST CORTESE Higher 2182, 0.413, NNW G35 UNOCAL #5330 5001 BALL RD SWEEPS UST, CA FID UST, HIST CORTESE Higher 2073, 0.393, NNW G34 ROBERT KAHN PROPERTY 5001 CERRITOS LUST Higher 2073, 0.393, NNW 33 LTP MODERN MACHINE I 10900 WALKER ST RCRA NonGen / NLR Higher 1183, 0.224, ENE F32 11052 VIA EL MERCADO AST Higher 913, 0.173, SE F31 COOLANT MANAGEMENT S 11052 VIA EL MERCADO AST Higher 913, 0.173, SE F30 COOLANT MANAGEMENT S 11052 VIA EL MERCADO RCRA NonGen / NLR Higher 913, 0.173, SE E29 COSTCO WHOLESALE NO 5401 KATELLA AVE RCRA-LQG, HAZNET Higher 896, 0.170, ENE E28 COSTCO WHOLESALE #74 10901 WALKER ST UST Higher 896, 0.170, ENE 27 GEORGE TOWNSHEND SFR 11132 MINDORA STREET RCRA NonGen / NLR Lower 766, 0.145, South C26 ENVIROCON INC 11082 WINNERS CIRCLE RCRA NonGen / NLR, FINDS, ECHO Lower 647, 0.123, SSE D25 COSTCO WHOLESALE #74 5401 KATELLA AVE UST Higher 586, 0.111, ESE D24 REPLANET LLC 5401 KATELLA AVE SWRCY, CHMIRS Higher 586, 0.111, ESE 23 CYPRESS GOLF CLUB 4921 KATELLA LUST, NPDES Lower 566, 0.107, WNW B22 OFFICE DEPOT 2281 4955 KATELLA AVE RCRA NonGen / NLR Lower 555, 0.105, WSW B21 ISLAND CLEANERS 4959 KATELLA AVE EDR Hist Cleaner Lower 552, 0.105, WSW B20 LOS ALAMITOS RACE CO 4961 KATELLA LUST, ENF, HIST CORTESE, NPDES, CIWQS Lower 549, 0.104, WSW B19 4961 KATELLA AVE AST Lower 549, 0.104, WSW B18 LOS ALAMITOS RACE TR 4961 E KATELLA RCRA-SQG, LUST, SWEEPS UST, CA FID UST, Orange Co.... Lower 549, 0.104, WSW C17 K&A IMPORTS 11061 WINNER CIRCLE RCRA-SQG, HAZNET Lower 496, 0.094, SSE C16 K & A IMPORT SERVICE 11061 WINNERS CIRCLE RCRA-SQG, FINDS, ECHO Lower 496, 0.094, SSE A15 DUTCH BOY DRY CLEANE 5131 ANTIETAM AVE EDR Hist Cleaner Higher 409, 0.077, SSW B14 ALAMITOS CLEANERS 5074-78 KATELLA AVE DRYCLEANERS Lower 407, 0.077, WSW B13 ALAMITOS LAUNDRY & D 5074 KATELLA AVE DRYCLEANERS Lower 407, 0.077, WSW B12 ALAMITOS CLEANERS 5074 KATELLA AVE DRYCLEANERS Lower 407, 0.077, WSW B11 ALAMITOS CLEANERS AN 5074 KATELLA AV EDR Hist Cleaner Lower 407, 0.077, WSW B10 RACER CLEANERS 5074 KATELLA AVE DRYCLEANERS Lower 407, 0.077, WSW 9 TILOS EUROPEAN AUTOH 5300 KATELLA AVE RCRA NonGen / NLR, FINDS, ECHO, HAZNET Higher 266, 0.050, SE A8 5100 KATELLA RCRA-LQG Higher 226, 0.043, SW A7 SERVICE STATION 5511 5100 KATELLA HIST UST Higher 226, 0.043, SW A6 TOSCO #5680 5100 KATELLA AVE UST Higher 226, 0.043, SW A5 INNABI UNION 76 #1 5100 KATELLA AVE SWEEPS UST, CA FID UST, HAZNET, HIST CORTESE Higher 226, 0.043, SW A4 UNION OIL SERVICE ST 5100 KATELLA LUST, HIST UST Higher 226, 0.043, SW A3 KINCHER GARY 5100 KATELLA EDR Hist Auto Higher 226, 0.043, SW A2 BARKER ROBERT H 5122 KATELLA AVE EDR Hist Auto Higher 159, 0.030, SW A1 NELSON PAIDDS & SUSA 5122 KATELLA RCRA NonGen / NLR Higher 159, 0.030, SW Reg LOS ALAMITOS ARMED F DOD Same 1220, 0.231, South MAPPED SITES SUMMARY Target Property Address: NOT REPORTED LOS ALAMITOS, CA 90720 Click on Map ID to see full detail. MAP RELATIVE DIST (ft. & mi.) ID DATABASE ACRONYMS ELEVATION DIRECTIONSITE NAME ADDRESS 5646263.2s Page 3 I43 NAS LOS ALAMITOS ENVIROSTOR Lower 5050, 0.956, SW I42 LOS ALAMITOS RAD BOM ENVIROSTOR Lower 5050, 0.956, SW 41 THE BOEING COMPANY 10800 VALLEY VIEW ST ENVIROSTOR, Orange Co. Industrial Site, EMI,... Higher 4017, 0.761, East 40 JOINT FORCES TRAININ 4250 CONSTITUTION AV RESPONSE, ENVIROSTOR, LUST Lower 3628, 0.687, WSW H39 ARROWHEAD PRODUCTS 4411 KATELLA AVENUE ENVIROSTOR Lower 3609, 0.684, West MAPPED SITES SUMMARY Target Property Address: NOT REPORTED LOS ALAMITOS, CA 90720 Click on Map ID to see full detail. MAP RELATIVE DIST (ft. & mi.) ID DATABASE ACRONYMS ELEVATION DIRECTIONSITE NAME ADDRESS EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 4 TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR. DATABASES WITH NO MAPPED SITES No mapped sites were found in EDR’s search of available ("reasonably ascertainable ") government records either on the target property or within the search radius around the target property for the following databases: STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL National Priority List Proposed NPL Proposed National Priority List Sites NPL LIENS Federal Superfund Liens Federal Delisted NPL site list Delisted NPL National Priority List Deletions Federal CERCLIS list FEDERAL FACILITY Federal Facility Site Information listing SEMS Superfund Enterprise Management System Federal CERCLIS NFRAP site list SEMS-ARCHIVE Superfund Enterprise Management System Archive Federal RCRA CORRACTS facilities list CORRACTS Corrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDF RCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-CESQG RCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries LUCIS Land Use Control Information System US ENG CONTROLS Engineering Controls Sites List US INST CONTROL Sites with Institutional Controls Federal ERNS list ERNS Emergency Response Notification System EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 5 State and tribal landfill and/or solid waste disposal site lists SWF/LF Solid Waste Information System State and tribal leaking storage tank lists INDIAN LUST Leaking Underground Storage Tanks on Indian Land CPS-SLIC Statewide SLIC Cases State and tribal registered storage tank lists FEMA UST Underground Storage Tank Listing INDIAN UST Underground Storage Tanks on Indian Land State and tribal voluntary cleanup sites VCP Voluntary Cleanup Program Properties INDIAN VCP Voluntary Cleanup Priority Listing State and tribal Brownfields sites BROWNFIELDS Considered Brownfieds Sites Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS A Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites WMUDS/SWAT Waste Management Unit Database HAULERS Registered Waste Tire Haulers Listing INDIAN ODI Report on the Status of Open Dumps on Indian Lands ODI Open Dump Inventory DEBRIS REGION 9 Torres Martinez Reservation Illegal Dump Site Locations IHS OPEN DUMPS Open Dumps on Indian Land Local Lists of Hazardous waste / Contaminated Sites US HIST CDL Delisted National Clandestine Laboratory Register HIST Cal-Sites Historical Calsites Database SCH School Property Evaluation Program CDL Clandestine Drug Labs CERS HAZ WASTE CERS HAZ WASTE Toxic Pits Toxic Pits Cleanup Act Sites US CDL National Clandestine Laboratory Register PFAS PFAS Contamination Site Location Listing Local Lists of Registered Storage Tanks CERS TANKS California Environmental Reporting System (CERS) Tanks Local Land Records LIENS Environmental Liens Listing EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 6 LIENS 2 CERCLA Lien Information DEED Deed Restriction Listing Records of Emergency Release Reports HMIRS Hazardous Materials Information Reporting System CHMIRS California Hazardous Material Incident Report System LDS Land Disposal Sites Listing MCS Military Cleanup Sites Listing Orange Co. Industrial Site List of Industrial Site Cleanups SPILLS 90 SPILLS 90 data from FirstSearch Other Ascertainable Records FUDS Formerly Used Defense Sites SCRD DRYCLEANERS State Coalition for Remediation of Drycleaners Listing US FIN ASSUR Financial Assurance Information EPA WATCH LIST EPA WATCH LIST 2020 COR ACTION 2020 Corrective Action Program List TSCA Toxic Substances Control Act TRIS Toxic Chemical Release Inventory System SSTS Section 7 Tracking Systems ROD Records Of Decision RMP Risk Management Plans RAATS RCRA Administrative Action Tracking System PRP Potentially Responsible Parties PADS PCB Activity Database System ICIS Integrated Compliance Information System FTTS FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act) MLTS Material Licensing Tracking System COAL ASH DOE Steam-Electric Plant Operation Data COAL ASH EPA Coal Combustion Residues Surface Impoundments List PCB TRANSFORMER PCB Transformer Registration Database RADINFO Radiation Information Database HIST FTTS FIFRA/TSCA Tracking System Administrative Case Listing DOT OPS Incident and Accident Data CONSENT Superfund (CERCLA) Consent Decrees INDIAN RESERV Indian Reservations FUSRAP Formerly Utilized Sites Remedial Action Program UMTRA Uranium Mill Tailings Sites LEAD SMELTERS Lead Smelter Sites US AIRS Aerometric Information Retrieval System Facility Subsystem US MINES Mines Master Index File ABANDONED MINES Abandoned Mines FINDS Facility Index System/Facility Registry System DOCKET HWC Hazardous Waste Compliance Docket Listing ECHO Enforcement & Compliance History Information UXO Unexploded Ordnance Sites FUELS PROGRAM EPA Fuels Program Registered Listing CA BOND EXP. PLAN Bond Expenditure Plan Cortese "Cortese" Hazardous Waste & Substances Sites List CUPA Listings CUPA Resources List EMI Emissions Inventory Data ENF Enforcement Action Listing EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 7 Financial Assurance Financial Assurance Information Listing HAZNET Facility and Manifest Data ICE ICE HWP EnviroStor Permitted Facilities Listing HWT Registered Hazardous Waste Transporter Database MINES Mines Site Location Listing MWMP Medical Waste Management Program Listing NPDES NPDES Permits Listing PEST LIC Pesticide Regulation Licenses Listing PROC Certified Processors Database Notify 65 Proposition 65 Records UIC UIC Listing UIC GEO UIC GEO (GEOTRACKER) WASTEWATER PITS Oil Wastewater Pits Listing WDS Waste Discharge System MILITARY PRIV SITES MILITARY PRIV SITES (GEOTRACKER) PROJECT PROJECT (GEOTRACKER) WDR Waste Discharge Requirements Listing CIWQS California Integrated Water Quality System CERS CERS WIP Well Investigation Program Case List NON-CASE INFO NON-CASE INFO (GEOTRACKER) OTHER OIL GAS OTHER OIL & GAS (GEOTRACKER) PROD WATER PONDS PROD WATER PONDS (GEOTRACKER) SAMPLING POINT SAMPLING POINT (GEOTRACKER) WELL STIM PROJ Well Stimulation Project (GEOTRACKER) EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR MGP EDR Proprietary Manufactured Gas Plants EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives RGA LF Recovered Government Archive Solid Waste Facilities List RGA LUST Recovered Government Archive Leaking Underground Storage Tank SURROUNDING SITES: SEARCH RESULTS Surrounding sites were identified in the following databases. Elevations have been determined from the USGS Digital Elevation Model and should be evaluated on a relative (not an absolute) basis. Relative elevation information between sites of close proximity should be field verified. Sites with an elevation equal to or higher than the target property have been differentiated below from sites with an elevation lower than the target property. Page numbers and map identification numbers refer to the EDR Radius Map report where detailed data on individual sites can be reviewed. Sites listed in bold italics are in multiple databases. Unmappable (orphan) sites are not considered in the foregoing analysis. EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 8 STANDARD ENVIRONMENTAL RECORDS Federal RCRA generators list RCRA-LQG: RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month. A review of the RCRA-LQG list, as provided by EDR, and dated 03/25/2019 has revealed that there are 2 RCRA-LQG sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ Not reported 5100 KATELLA SW 0 - 1/8 (0.043 mi.) A8 20 EPA ID:: CAL000169176 COSTCO WHOLESALE NO 5401 KATELLA AVE ENE 1/8 - 1/4 (0.170 mi.) E29 66 EPA ID:: CAR000160200 RCRA-SQG: RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate between 100 kg and 1,000 kg of hazardous waste per month. A review of the RCRA-SQG list, as provided by EDR, and dated 03/25/2019 has revealed that there are 3 RCRA-SQG sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ K & A IMPORT SERVICE 11061 WINNERS CIRCLE SSE 0 - 1/8 (0.094 mi.) C16 27 EPA ID:: CAD981445026 K&A IMPORTS 11061 WINNER CIRCLE SSE 0 - 1/8 (0.094 mi.) C17 28 EPA ID:: CAD981443161 LOS ALAMITOS RACE TR 4961 E KATELLA WSW 0 - 1/8 (0.104 mi.) B18 30 EPA ID:: CAD981684483 State- and tribal - equivalent NPL RESPONSE: Identifies confirmed release sites where DTSC is involved in remediation, either in a lead or oversight capacity. These confirmed release sites are generally high-priority and high potential risk. A review of the RESPONSE list, as provided by EDR, has revealed that there is 1 RESPONSE site within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ JOINT FORCES TRAININ 4250 CONSTITUTION AV WSW 1/2 - 1 (0.687 mi.) 40 105 Database: RESPONSE, Date of Government Version: 01/28/2019 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 9 Status: No Further Action Facility Id: 30490037 State- and tribal - equivalent CERCLIS ENVIROSTOR: The Department of Toxic Substances Control’s (DTSC’s) Site Mitigation and Brownfields Reuse Program’s (SMBRP’s) EnviroStor database identifes sites that have known contamination or sites for which there may be reasons to investigate further. The database includes the following site types: Federal Superfund sites (National Priorities List (NPL)); State Response, including Military Facilities and State Superfund; Voluntary Cleanup; and School sites. EnviroStor provides similar information to the information that was available in CalSites, and provides additional site information, including, but not limited to, identification of formerly-contaminated properties that have been released for reuse, properties where environmental deed restrictions have been recorded to prevent inappropriate land uses, and risk characterization information that is used to assess potential impacts to public health and the environment at contaminated sites. A review of the ENVIROSTOR list, as provided by EDR, and dated 01/28/2019 has revealed that there are 7 ENVIROSTOR sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ R & D BLDG PARCEL 7 5730 KATELLA AVE ESE 1/4 - 1/2 (0.424 mi.) 37 90 Facility Id: 60002729 Status: Active THE BOEING COMPANY 10800 VALLEY VIEW ST E 1/2 - 1 (0.761 mi.) 41 110 Facility Id: 30990005 Status: Refer: 1248 Local Agency PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ VESPER CORP 4411 KATELLA AV W 1/2 - 1 (0.684 mi.) H38 93 Facility Id: 30370008 Status: Refer: Local Agency ARROWHEAD PRODUCTS 4411 KATELLA AVENUE W 1/2 - 1 (0.684 mi.) H39 104 Facility Id: 60002104 Status: Active JOINT FORCES TRAININ 4250 CONSTITUTION AV WSW 1/2 - 1 (0.687 mi.) 40 105 Facility Id: 30490037 Status: No Further Action LOS ALAMITOS RAD BOM SW 1/2 - 1 (0.956 mi.) I42 113 Facility Id: 80000425 Status: Inactive - Needs Evaluation NAS LOS ALAMITOS SW 1/2 - 1 (0.956 mi.) I43 115 Facility Id: 80000646 Status: Inactive - Needs Evaluation EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 10 State and tribal leaking storage tank lists LUST: Leaking Underground Storage Tank (LUST) Sites included in GeoTracker. GeoTracker is the Water Boards data management system for sites that impact, or have the potential to impact, water quality in California, with emphasis on groundwater. A review of the LUST list, as provided by EDR, has revealed that there are 6 LUST sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ UNION OIL SERVICE ST 5100 KATELLA SW 0 - 1/8 (0.043 mi.) A4 10 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: ORANGE CO. LUST, Date of Government Version: 01/02/2019 Database: LUST, Date of Government Version: 12/10/2018 Status: Completed - Case Closed Facility Id: 87UT114 Facility Status: Remedial action (cleanup) Underway Global Id: T0605900471 Global ID: T0605900471 ROBERT KAHN PROPERTY 5001 CERRITOS NNW 1/4 - 1/2 (0.393 mi.) G34 81 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: ORANGE CO. LUST, Date of Government Version: 01/02/2019 Database: LUST, Date of Government Version: 12/10/2018 Status: Completed - Case Closed Facility Id: 91UT095 Facility Status: Case Closed Global Id: T0605901416 Global ID: T0605901416 ORANGE COUNTY FIRE S 4991 CERRITOS NNW 1/4 - 1/2 (0.413 mi.) 36 86 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: ORANGE CO. LUST, Date of Government Version: 01/02/2019 Database: LUST, Date of Government Version: 12/10/2018 Status: Completed - Case Closed Facility Id: 97UT031 Facility Status: Case Closed Global Id: T0605902092 Global ID: T0605902092 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ LOS ALAMITOS RACE TR 4961 E KATELLA WSW 0 - 1/8 (0.104 mi.) B18 30 Database: LUST REG 8, Date of Government Version: 02/14/2005 Facility Status: Case Closed Global ID: T0605900836 Global ID: T0605902069 LOS ALAMITOS RACE CO 4961 KATELLA WSW 0 - 1/8 (0.104 mi.) B20 39 Database: ORANGE CO. LUST, Date of Government Version: 01/02/2019 Database: LUST, Date of Government Version: 12/10/2018 Status: Completed - Case Closed Facility Id: 88UT153 Facility Id: 97UT016 Global Id: T0605902069 Global Id: T0605900836 CYPRESS GOLF CLUB 4921 KATELLA WNW 0 - 1/8 (0.107 mi.) 23 50 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: ORANGE CO. LUST, Date of Government Version: 01/02/2019 Database: LUST, Date of Government Version: 12/10/2018 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 11 Status: Completed - Case Closed Facility Id: 04UT011 Facility Status: Preliminary site assessment underway Global Id: T0605997341 Global ID: T0605997341 State and tribal registered storage tank lists UST: The Underground Storage Tank database contains registered USTs. USTs are regulated under Subtitle I of the Resource Conservation and Recovery Act (RCRA). The data come from the State Water Resources Control Board’s Hazardous Substance Storage Container Database. A review of the UST list, as provided by EDR, has revealed that there are 3 UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TOSCO #5680 5100 KATELLA AVE SW 0 - 1/8 (0.043 mi.) A6 19 Database: ORANGE CO. UST, Date of Government Version: 01/02/2019 Database: UST, Date of Government Version: 12/10/2018 Facility Id: FA0051673 Facility Id: 18767 COSTCO WHOLESALE #74 5401 KATELLA AVE ESE 0 - 1/8 (0.111 mi.) D25 61 Database: UST, Date of Government Version: 12/10/2018 Facility Id: FA0064582 COSTCO WHOLESALE #74 10901 WALKER ST ENE 1/8 - 1/4 (0.170 mi.) E28 66 Database: ORANGE CO. UST, Date of Government Version: 01/02/2019 Database: UST, Date of Government Version: 12/10/2018 Facility Id: FA0045719 Facility Id: FA0045719 AST: A listing of aboveground storage tank petroleum storage tank locations. A review of the AST list, as provided by EDR, has revealed that there are 3 AST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ COOLANT MANAGEMENT S 11052 VIA EL MERCADO SE 1/8 - 1/4 (0.173 mi.) F31 78 Database: AST, Date of Government Version: 07/06/2016 Not reported 11052 VIA EL MERCADO SE 1/8 - 1/4 (0.173 mi.) F32 79 Database: AST, Date of Government Version: 07/06/2016 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ Not reported 4961 KATELLA AVE WSW 0 - 1/8 (0.104 mi.) B19 38 Database: AST, Date of Government Version: 07/06/2016 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 12 ADDITIONAL ENVIRONMENTAL RECORDS Local Lists of Landfill / Solid Waste Disposal Sites SWRCY: A listing of recycling facilities in California. A review of the SWRCY list, as provided by EDR, and dated 03/11/2019 has revealed that there is 1 SWRCY site within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ REPLANET LLC 5401 KATELLA AVE ESE 0 - 1/8 (0.111 mi.) D24 60 Cert Id: RC218172.001 Local Lists of Registered Storage Tanks SWEEPS UST: Statewide Environmental Evaluation and Planning System. This underground storage tank listing was updated and maintained by a company contacted by the SWRCB in the early 1990’s. The listing is no longer updated or maintained. The local agency is the contact for more information on a site on the SWEEPS list. A review of the SWEEPS UST list, as provided by EDR, and dated 06/01/1994 has revealed that there are 2 SWEEPS UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ INNABI UNION 76 #1 5100 KATELLA AVE SW 0 - 1/8 (0.043 mi.) A5 16 Status: A Tank Status: A Comp Number: 136 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ LOS ALAMITOS RACE TR 4961 E KATELLA WSW 0 - 1/8 (0.104 mi.) B18 30 Status: A Tank Status: A Comp Number: 5314 HIST UST: Historical UST Registered Database. A review of the HIST UST list, as provided by EDR, and dated 10/15/1990 has revealed that there are 2 HIST UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ UNION OIL SERVICE ST 5100 KATELLA SW 0 - 1/8 (0.043 mi.) A4 10 Facility Id: 00000056204 SERVICE STATION 5511 5100 KATELLA SW 0 - 1/8 (0.043 mi.) A7 19 Facility Id: 00000008023 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 13 CA FID UST: The Facility Inventory Database contains active and inactive underground storage tank locations. The source is the State Water Resource Control Board. A review of the CA FID UST list, as provided by EDR, and dated 10/31/1994 has revealed that there are 2 CA FID UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ INNABI UNION 76 #1 5100 KATELLA AVE SW 0 - 1/8 (0.043 mi.) A5 16 Facility Id: 30000665 Status: A PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ LOS ALAMITOS RACE TR 4961 E KATELLA WSW 0 - 1/8 (0.104 mi.) B18 30 Facility Id: 30000858 Status: A Other Ascertainable Records RCRA NonGen / NLR: RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous waste. A review of the RCRA NonGen / NLR list, as provided by EDR, and dated 03/25/2019 has revealed that there are 7 RCRA NonGen / NLR sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ NELSON PAIDDS & SUSA 5122 KATELLA SW 0 - 1/8 (0.030 mi.) A1 8 EPA ID:: CAL000259066 TILOS EUROPEAN AUTOH 5300 KATELLA AVE SE 0 - 1/8 (0.050 mi.) 9 21 EPA ID:: CAR000078394 COOLANT MANAGEMENT S 11052 VIA EL MERCADO SE 1/8 - 1/4 (0.173 mi.) F30 77 EPA ID:: CAL000229936 LTP MODERN MACHINE I 10900 WALKER ST ENE 1/8 - 1/4 (0.224 mi.) 33 80 EPA ID:: CAL000420984 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ OFFICE DEPOT 2281 4955 KATELLA AVE WSW 0 - 1/8 (0.105 mi.) B22 49 EPA ID:: CAL000420839 ENVIROCON INC 11082 WINNERS CIRCLE SSE 0 - 1/8 (0.123 mi.) C26 62 EPA ID:: CAD983586744 GEORGE TOWNSHEND SFR 11132 MINDORA STREET S 1/8 - 1/4 (0.145 mi.) 27 65 EPA ID:: CAC002982790 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 14 DOD: Consists of federally owned or administered lands, administered by the Department of Defense, that have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands. A review of the DOD list, as provided by EDR, and dated 12/31/2005 has revealed that there is 1 DOD site within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ LOS ALAMITOS ARMED F S 1/8 - 1/4 (0.231 mi.) 0 8 DRYCLEANERS: A list of drycleaner related facilities that have EPA ID numbers. These are facilities with certain SIC codes: power laundries, family and commercial; garment pressing and cleaners’ agents; linen supply; coin-operated laundries and cleaning; drycleaning plants except rugs; carpet and upholster cleaning; industrial launderers; laundry and garment services. A review of the DRYCLEANERS list, as provided by EDR, has revealed that there are 4 DRYCLEANERS sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ RACER CLEANERS 5074 KATELLA AVE WSW 0 - 1/8 (0.077 mi.) B10 23 Database: DRYCLEANERS, Date of Government Version: 12/13/2018 Database: DRYCLEAN SOUTH COAST, Date of Government Version: 03/19/2019 EPA Id: CAL000268799 EPA Id: CAL000345982 ALAMITOS CLEANERS 5074 KATELLA AVE WSW 0 - 1/8 (0.077 mi.) B12 25 Database: DRYCLEAN SOUTH COAST, Date of Government Version: 03/19/2019 ALAMITOS LAUNDRY & D 5074 KATELLA AVE WSW 0 - 1/8 (0.077 mi.) B13 26 Database: DRYCLEAN SOUTH COAST, Date of Government Version: 03/19/2019 ALAMITOS CLEANERS 5074-78 KATELLA AVE WSW 0 - 1/8 (0.077 mi.) B14 26 Database: DRYCLEAN SOUTH COAST, Date of Government Version: 03/19/2019 HIST CORTESE: The sites for the list are designated by the State Water Resource Control Board [LUST], the Integrated Waste Board [SWF/LS], and the Department of Toxic Substances Control [CALSITES]. This listing is no longer updated by the state agency. A review of the HIST CORTESE list, as provided by EDR, and dated 04/01/2001 has revealed that there are 5 HIST CORTESE sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ INNABI UNION 76 #1 5100 KATELLA AVE SW 0 - 1/8 (0.043 mi.) A5 16 Reg Id: 083000585T UNOCAL #5330 5001 BALL RD NNW 1/4 - 1/2 (0.393 mi.) G35 83 Reg Id: 083002183T Reg Id: 083001897T ORANGE COUNTY FIRE S 4991 CERRITOS NNW 1/4 - 1/2 (0.413 mi.) 36 86 Reg Id: 083003072T PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ LOS ALAMITOS RACE TR 4961 E KATELLA WSW 0 - 1/8 (0.104 mi.) B18 30 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 15 Reg Id: 083003034T LOS ALAMITOS RACE CO 4961 KATELLA WSW 0 - 1/8 (0.104 mi.) B20 39 Reg Id: 083001061T EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR Hist Auto: EDR has searched selected national collections of business directories and has collected listings of potential gas station/filling station/service station sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include gas station/filling station/service station establishments. The categories reviewed included, but were not limited to gas, gas station, gasoline station, filling station, auto, automobile repair, auto service station, service station, etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. A review of the EDR Hist Auto list, as provided by EDR, has revealed that there are 2 EDR Hist Auto sites within approximately 0.125 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ BARKER ROBERT H 5122 KATELLA AVE SW 0 - 1/8 (0.030 mi.) A2 9 KINCHER GARY 5100 KATELLA SW 0 - 1/8 (0.043 mi.) A3 10 EDR Hist Cleaner: EDR has searched selected national collections of business directories and has collected listings of potential dry cleaner sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include dry cleaning establishments. The categories reviewed included, but were not limited to dry cleaners, cleaners, laundry, laundromat, cleaning/laundry, wash & dry etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. A review of the EDR Hist Cleaner list, as provided by EDR, has revealed that there are 3 EDR Hist Cleaner sites within approximately 0.125 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ DUTCH BOY DRY CLEANE 5131 ANTIETAM AVE SSW 0 - 1/8 (0.077 mi.) A15 27 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ ALAMITOS CLEANERS AN 5074 KATELLA AV WSW 0 - 1/8 (0.077 mi.) B11 25 ISLAND CLEANERS 4959 KATELLA AVE WSW 0 - 1/8 (0.105 mi.) B21 48 EXECUTIVE SUMMARY TC5646263.2s EXECUTIVE SUMMARY 16 Due to poor or inadequate address information, the following sites were not mapped. Count: 1 records. Site Name Database(s)____________ ____________ BENJAMIN B & MARIA L BARAJAS DBA DRYCLEANERS EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.60 kV40 40 4040 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0 NR 0 0 0 0 1.000NPL 0 NR 0 0 0 0 1.000Proposed NPL 0 NR NR NR NR 0 0.001NPL LIENS Federal Delisted NPL site list 0 NR 0 0 0 0 1.000Delisted NPL Federal CERCLIS list 0 NR NR 0 0 0 0.500FEDERAL FACILITY 0 NR NR 0 0 0 0.500SEMS Federal CERCLIS NFRAP site list 0 NR NR 0 0 0 0.500SEMS-ARCHIVE Federal RCRA CORRACTS facilities list 0 NR 0 0 0 0 1.000CORRACTS Federal RCRA non-CORRACTS TSD facilities list 0 NR NR 0 0 0 0.500RCRA-TSDF Federal RCRA generators list 2 NR NR NR 1 1 0.250RCRA-LQG 3 NR NR NR 0 3 0.250RCRA-SQG 0 NR NR NR 0 0 0.250RCRA-CESQG Federal institutional controls / engineering controls registries 0 NR NR 0 0 0 0.500LUCIS 0 NR NR 0 0 0 0.500US ENG CONTROLS 0 NR NR 0 0 0 0.500US INST CONTROL Federal ERNS list 0 NR NR NR NR 0 0.001ERNS State- and tribal - equivalent NPL 1 NR 1 0 0 0 1.000RESPONSE State- and tribal - equivalent CERCLIS 7 NR 6 1 0 0 1.000ENVIROSTOR State and tribal landfill and/or solid waste disposal site lists 0 NR NR 0 0 0 0.500SWF/LF State and tribal leaking storage tank lists 6 NR NR 2 0 4 0.500LUST TC5646263.2s Page 4 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 0 NR NR 0 0 0 0.500INDIAN LUST 0 NR NR 0 0 0 0.500CPS-SLIC State and tribal registered storage tank lists 0 NR NR NR 0 0 0.250FEMA UST 3 NR NR NR 1 2 0.250UST 3 NR NR NR 2 1 0.250AST 0 NR NR NR 0 0 0.250INDIAN UST State and tribal voluntary cleanup sites 0 NR NR 0 0 0 0.500VCP 0 NR NR 0 0 0 0.500INDIAN VCP State and tribal Brownfields sites 0 NR NR 0 0 0 0.500BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0 NR NR 0 0 0 0.500US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0 NR NR 0 0 0 0.500WMUDS/SWAT 1 NR NR 0 0 1 0.500SWRCY 0 NR NR NR NR 0 0.001HAULERS 0 NR NR 0 0 0 0.500INDIAN ODI 0 NR NR 0 0 0 0.500ODI 0 NR NR 0 0 0 0.500DEBRIS REGION 9 0 NR NR 0 0 0 0.500IHS OPEN DUMPS Local Lists of Hazardous waste / Contaminated Sites 0 NR NR NR NR 0 0.001US HIST CDL 0 NR 0 0 0 0 1.000HIST Cal-Sites 0 NR NR NR 0 0 0.250SCH 0 NR NR NR NR 0 0.001CDL 0 NR NR NR 0 0 0.250CERS HAZ WASTE 0 NR 0 0 0 0 1.000Toxic Pits 0 NR NR NR NR 0 0.001US CDL 0 NR NR NR NR 0 0.001PFAS Local Lists of Registered Storage Tanks 2 NR NR NR 0 2 0.250SWEEPS UST 2 NR NR NR 0 2 0.250HIST UST 0 NR NR NR 0 0 0.250CERS TANKS 2 NR NR NR 0 2 0.250CA FID UST Local Land Records 0 NR NR NR NR 0 0.001LIENS TC5646263.2s Page 5 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 0 NR NR NR NR 0 0.001LIENS 2 0 NR NR 0 0 0 0.500DEED Records of Emergency Release Reports 0 NR NR NR NR 0 0.001HMIRS 0 NR NR NR NR 0 0.001CHMIRS 0 NR NR NR NR 0 0.001LDS 0 NR NR NR NR 0 0.001MCS 0 NR NR NR NR 0 0.001Orange Co. Industrial Site 0 NR NR NR NR 0 0.001SPILLS 90 Other Ascertainable Records 7 NR NR NR 3 4 0.250RCRA NonGen / NLR 0 NR 0 0 0 0 1.000FUDS 1 NR 0 0 1 0 1.000DOD 0 NR NR 0 0 0 0.500SCRD DRYCLEANERS 0 NR NR NR NR 0 0.001US FIN ASSUR 0 NR NR NR NR 0 0.001EPA WATCH LIST 0 NR NR NR 0 0 0.2502020 COR ACTION 0 NR NR NR NR 0 0.001TSCA 0 NR NR NR NR 0 0.001TRIS 0 NR NR NR NR 0 0.001SSTS 0 NR 0 0 0 0 1.000ROD 0 NR NR NR NR 0 0.001RMP 0 NR NR NR NR 0 0.001RAATS 0 NR NR NR NR 0 0.001PRP 0 NR NR NR NR 0 0.001PADS 0 NR NR NR NR 0 0.001ICIS 0 NR NR NR NR 0 0.001FTTS 0 NR NR NR NR 0 0.001MLTS 0 NR NR NR NR 0 0.001COAL ASH DOE 0 NR NR 0 0 0 0.500COAL ASH EPA 0 NR NR NR NR 0 0.001PCB TRANSFORMER 0 NR NR NR NR 0 0.001RADINFO 0 NR NR NR NR 0 0.001HIST FTTS 0 NR NR NR NR 0 0.001DOT OPS 0 NR 0 0 0 0 1.000CONSENT 0 NR NR NR NR 0 0.001INDIAN RESERV 0 NR 0 0 0 0 1.000FUSRAP 0 NR NR 0 0 0 0.500UMTRA 0 NR NR NR NR 0 0.001LEAD SMELTERS 0 NR NR NR NR 0 0.001US AIRS 0 NR NR NR 0 0 0.250US MINES 0 NR NR NR NR 0 0.001ABANDONED MINES 0 NR NR NR NR 0 0.001FINDS 0 NR NR NR NR 0 0.001DOCKET HWC 0 NR NR NR NR 0 0.001ECHO 0 NR 0 0 0 0 1.000UXO 0 NR NR NR 0 0 0.250FUELS PROGRAM 0 NR 0 0 0 0 1.000CA BOND EXP. PLAN 0 NR NR 0 0 0 0.500Cortese TC5646263.2s Page 6 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 0 NR NR NR 0 0 0.250CUPA Listings 4 NR NR NR 0 4 0.250DRYCLEANERS 0 NR NR NR NR 0 0.001EMI 0 NR NR NR NR 0 0.001ENF 0 NR NR NR NR 0 0.001Financial Assurance 0 NR NR NR NR 0 0.001HAZNET 0 NR NR NR NR 0 0.001ICE 5 NR NR 2 0 3 0.500HIST CORTESE 0 NR 0 0 0 0 1.000HWP 0 NR NR NR 0 0 0.250HWT 0 NR NR NR NR 0 0.001MINES 0 NR NR NR 0 0 0.250MWMP 0 NR NR NR NR 0 0.001NPDES 0 NR NR NR NR 0 0.001PEST LIC 0 NR NR 0 0 0 0.500PROC 0 NR 0 0 0 0 1.000Notify 65 0 NR NR NR NR 0 0.001UIC 0 NR NR NR NR 0 0.001UIC GEO 0 NR NR 0 0 0 0.500WASTEWATER PITS 0 NR NR NR NR 0 0.001WDS 0 NR NR NR NR 0 0.001MILITARY PRIV SITES 0 NR NR NR NR 0 0.001PROJECT 0 NR NR NR NR 0 0.001WDR 0 NR NR NR NR 0 0.001CIWQS 0 NR NR NR NR 0 0.001CERS 0 NR NR NR 0 0 0.250WIP 0 NR NR NR NR 0 0.001NON-CASE INFO 0 NR NR NR NR 0 0.001OTHER OIL GAS 0 NR NR NR NR 0 0.001PROD WATER PONDS 0 NR NR NR NR 0 0.001SAMPLING POINT 0 NR NR NR NR 0 0.001WELL STIM PROJ EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records 0 NR 0 0 0 0 1.000EDR MGP 2 NR NR NR NR 2 0.125EDR Hist Auto 3 NR NR NR NR 3 0.125EDR Hist Cleaner EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives 0 NR NR NR NR 0 0.001RGA LF 0 NR NR NR NR 0 0.001RGA LUST 54 0 7 5 8 34 0- Totals -- NOTES: TP = Target Property NR = Not Requested at this Search Distance Sites may be listed in more than one database TC5646263.2s Page 7 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation CAORANGETile name: YesDOD Site: CAState: Not reportedName 3: Not reportedName 2: Los Alamitos Armed Forces Reserve CenterName 1: Not reportedURL: Not reportedFeature 3: Not reportedFeature 2: Army DODFeature 1: DOD: 1220 ft. 1/8-1/4 South LOS ALAMITOS ARMED FORCES (County), CA Region N/A DOD DODLOS ALAMITOS ARMED FORCES RESERVE CENTER CUSA143754 LOS ALAMITOS, CA 90720 5122 KATELLA AVE STE 112Owner/operator address: DR PAIOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-493-2807Owner/operator telephone: Not reportedOwner/operator country: LOS ALAMITOS, CA 90720 5122 KATELLA AVE STE 112Owner/operator address: NELSON PAI DDS & SUSAN ISHIKA DDS MOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: NELSONPAIDDS@YAHOO.COMContact email: 562-493-2807Contact telephone: Not reportedContact country: LOS ALAMITOS, CA 90720 5122 KATELLA AVE STE 112Contact address: DR PAIContact: LOS ALAMITOS, CA 90720-2837 5122 KATELLA STE 112Mailing address: CAL000259066EPA ID: LOS ALAMITOS, CA 90720 5122 KATELLAFacility address: NELSON PAIDDS & SUSAN ISHIOKA DDS MS INCFacility name: 09/11/2002Date form received by agency: RCRA NonGen / NLR: 159 ft. Site 1 of 9 in cluster A 0.030 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5122 KATELLA CAL000259066 A1 RCRA NonGen / NLRNELSON PAIDDS & SUSAN ISHIOKA DDS MS INC 1024804597 TC5646263.2s Page 8 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: YesTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-493-2807Owner/operator telephone: Not reportedOwner/operator country: NELSON PAIDDS & SUSAN ISHIOKA DDS MS INC (Continued) 1024804597 Gasoline Service Stations1983 BARKER ROBERT H Gasoline Service Stations1982 BARKER ROBERT H Gasoline Service Stations1980 BARKER ROBERT H Gasoline Service Stations1979 BARKER ROBERT H Gasoline Service Stations1978 BARKER ROBERT H Gasoline Service Stations1977 BARKER ROBERT H Gasoline Service Stations1976 BARKER ROBERT H Gasoline Service Stations1975 BARKER ROBERT H Gasoline Service Stations1974 BARKER ROBERT H Gasoline Service Stations1973 BARKER ROBERT H Gasoline Service Stations1972 BARKER ROBERT H Gasoline Service Stations1971 BARKER ROBERT H Gasoline Service Stations1970 BARKER ROBERT H Gasoline Service Stations1969 BARKER ROBERT H Type:Year: Name: EDR Hist Auto 159 ft. Site 2 of 9 in cluster A 0.030 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5122 KATELLA AVE N/A A2 EDR Hist AutoBARKER ROBERT H 1021609418 TC5646263.2s Page 9 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Gasoline Service Stations2014 KATELLA 76 Gasoline Service Stations2014 HASSAN & SONS INC Gasoline Service Stations2013 KATELLA 76 Gasoline Service Stations2013 HASSAN & SONS INC Gasoline Service Stations2012 HASSAN & SONS INC Gasoline Service Stations2012 KATELLA 76 Gasoline Service Stations2011 KATELLA 76 Gasoline Service Stations2010 KATELLA 76 Gasoline Service Stations2009 KATELLA 76 Gasoline Service Stations2008 KATELLA 76 Gasoline Service Stations2007 KATELLA 76 Gasoline Service Stations2006 KATELLA 76 Gasoline Service Stations2005 KATELLA 76 Gasoline Service Stations2004 KATELLA 76 Gasoline Service Stations2003 KATELLA 76 Gasoline Service Stations2002 KATELLA 76 Gasoline Service Stations1998 TUSCO MARKETING CO Gasoline Service Stations1997 UNION 76 Gasoline Service Stations1996 UNION 76 Gasoline Service Stations1995 UNION 76 Gasoline Service Stations1994 UNION 76 Gasoline Service Stations1993 UNION 76 Gasoline Service Stations1992 UNION 76 Gasoline Service Stations1991 UNION 76 Gasoline Service Stations1990 UNION 76 Gasoline Service Stations1989 UNION 76 Gasoline Service Stations1971 KINCHER GARY Gasoline Service Stations1970 KINCHER GARY Gasoline Service Stations1969 KINCHER GARY Type:Year: Name: EDR Hist Auto 226 ft. Site 3 of 9 in cluster A 0.043 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5100 KATELLA N/A A3 EDR Hist AutoKINCHER GARY 1020594478 Aquifer used for drinking water supplyPotential Media Affect: 87UT114Local Case Number: Local AgencyFile Location: ORANGE COUNTY LOPLocal Agency: 083000585TRB Case Number: KLCase Worker: 09/23/2015Status Date: Completed - Case ClosedStatus: -118.0436072Longitude: 33.8029259Latitude: T0605900471Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605900471Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: LUST: 226 ft. Site 4 of 9 in cluster A 0.043 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW HIST UST5100 KATELLA N/A A4 LUSTUNION OIL SERVICE STATION 5511 1000166553 TC5646263.2s Page 10 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation T0605900471Global Id: Staff LetterAction: 07/14/2009Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 04/28/2009Date: ENFORCEMENTAction Type: T0605900471Global Id: Leak ReportedAction: 05/19/1987Date: OtherAction Type: T0605900471Global Id: Closure/No Further Action LetterAction: 09/23/2015Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 10/06/2008Date: ENFORCEMENTAction Type: T0605900471Global Id: Request for Closure - Regulator RespondedAction: 12/17/2012Date: RESPONSEAction Type: T0605900471Global Id: LUST: Not reportedPhone Number: nolson-martin@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: NANCY OLSON-MARTINContact Name: Regional Board CaseworkerContact Type: T0605900471Global Id: 7144336261Phone Number: klambert@ochca.comEmail: SANTA ANACity: 1241 E DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: KEVIN LAMBERTContact Name: Local Agency CaseworkerContact Type: T0605900471Global Id: LUST: submitted by consultants for the responsible party. accuracy of any professional interpretations provided in reports GeoTracker for site history. Orange County is not responsible for the Please refer to recent Site Documents or Monitoring Reports inSite History: GasolinePotential Contaminants of Concern: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 TC5646263.2s Page 11 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 01/09/2015Date: ENFORCEMENTAction Type: T0605900471Global Id: Notification - Public Notice of Case ClosureAction: 10/29/2014Date: ENFORCEMENTAction Type: T0605900471Global Id: File reviewAction: 08/13/2013Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 12/19/2012Date: ENFORCEMENTAction Type: T0605900471Global Id: File reviewAction: 10/18/2012Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 08/09/2011Date: ENFORCEMENTAction Type: T0605900471Global Id: File reviewAction: 05/10/2011Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 11/09/2009Date: ENFORCEMENTAction Type: T0605900471Global Id: In Situ Physical/Chemical Treatment (other than SVE)Action: 11/03/2004Date: REMEDIATIONAction Type: T0605900471Global Id: Pump & Treat (P&T) GroundwaterAction: 01/01/1991Date: REMEDIATIONAction Type: T0605900471Global Id: ExcavationAction: 05/19/1987Date: REMEDIATIONAction Type: T0605900471Global Id: LOP Case Closure Summary to RBAction: 09/23/2015Date: ENFORCEMENTAction Type: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 TC5646263.2s Page 12 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation T0605900471Global Id: 05/17/1987Status Date: Open - Case Begin DateStatus: T0605900471Global Id: 09/23/2015Status Date: Completed - Case ClosedStatus: T0605900471Global Id: LUST: Staff LetterAction: 11/19/2003Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 07/19/2004Date: ENFORCEMENTAction Type: T0605900471Global Id: Staff LetterAction: 04/05/2004Date: ENFORCEMENTAction Type: T0605900471Global Id: Leak DiscoveryAction: 05/19/1987Date: OtherAction Type: T0605900471Global Id: Leak BeganAction: 05/19/1987Date: OtherAction Type: T0605900471Global Id: ExcavationAction: 11/01/1996Date: REMEDIATIONAction Type: T0605900471Global Id: ExcavationAction: 12/01/1990Date: REMEDIATIONAction Type: T0605900471Global Id: Soil Vapor Extraction (SVE)Action: 12/01/2000Date: REMEDIATIONAction Type: T0605900471Global Id: Notification - Public Participation DocumentAction: 10/29/2014Date: ENFORCEMENTAction Type: T0605900471Global Id: Notification - PreclosureAction: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 TC5646263.2s Page 13 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation UnknownLeak Cause: New TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: SELEnf Type: Not reportedCross Street: Not reportedAbate Method: 0Qty Leaked: GasolineSubstance: Other ground water affectedCase Type: 87UT114Local Case Num: 083000585TCase Number: Remedial action (cleanup) UnderwayFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: RO0001279Record ID: 09/23/2015Date Closed: Gasoline-Automotive (motor gasoline and additives), leaded & unleadedReleased Substance: 87UT114Facility Id: ORANGERegion: ORANGE CO. LUST: 08/09/2011Status Date: Open - Site AssessmentStatus: T0605900471Global Id: 10/15/1990Status Date: Open - Site AssessmentStatus: T0605900471Global Id: 03/17/1988Status Date: Open - Site AssessmentStatus: T0605900471Global Id: 07/01/1987Status Date: Open - Site AssessmentStatus: T0605900471Global Id: 05/17/1987Status Date: Open - Site AssessmentStatus: T0605900471Global Id: 12/31/2000Status Date: Open - RemediationStatus: T0605900471Global Id: 11/01/1999Status Date: Open - RemediationStatus: T0605900471Global Id: 03/13/2013Status Date: Open - Eligible for ClosureStatus: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 TC5646263.2s Page 14 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 1Container Num: 001Tank Num: 0001Total Tanks: LOS ANGELES, CA 90010Owner City,St,Zip: 3701 WILSHIRE BOULEVARD-SUITEOwner Address: UNION OIL COMPANY OF CALIFORNIOwner Name: 7145964360Telephone: ROBERT HENRY BARKERContact Name: Not reportedOther Type: Gas StationFacility Type: 00000056204Facility ID: STATERegion: http://geotracker.waterboards.ca.gov/ustpdfs/pdf/0002D6E3.pdfURL: 0002D6E3File Number: HIST UST: Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: SSStaff Initials: NOMStaff: *MTBE Class: MTBE Detected. Site tested for MTBE & MTBE detectedMTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 0MTBE Concentration: 86000Max MTBE GW: 6/15/2004MTBE Date: -118.0436072Longitude: 33.8029259Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: =GW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: 12/31/2000Date Remedial Action Underway: 11/1/1999Date Remediation Plan Submitted: 10/15/1990Date Pollution Characterization Began: 7/1/1987Date Prelim Assessment Workplan Submitted: Not reportedClose Date: Not reportedEnforcement Date: 5/19/1987Discover Date: 3/17/1988Date Preliminary Assessment Began: 5/17/1987Date Confirmation of Leak Began: Not reportedEnter Date: 9/9/9999How Stopped Date: T0605900471Global ID: TankLeak Source: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 TC5646263.2s Page 15 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Click here for Geo Tracker PDF: NoneLeak Detection: Not reportedContainer Construction Thickness: WASTE OILType of Fuel: WASTETank Used for: 00000120Tank Capacity: Not reportedYear Installed: UNION OIL SERVICE STATION 5511 (Continued) 1000166553 Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-015749Board Of Equalization: 9Number: 136Comp Number: ActiveStatus: 2Number Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 12000Capacity: ATank Status: 30-000-000136-000001SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-015749Board Of Equalization: 9Number: 136Comp Number: ActiveStatus: 1Number Of Tanks: Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 500Capacity: Not reportedTank Status: 30-000-000136-000003SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: 44-015749Board Of Equalization: Not reportedNumber: 136Comp Number: Not reportedStatus: SWEEPS UST: 226 ft. Site 5 of 9 in cluster A 0.043 mi.HIST CORTESE Relative: Higher Actual: 32 ft. < 1/8 HAZNETLOS ALAMITOS, CA 90720 SW CA FID UST5100 KATELLA AVE N/A A5 SWEEPS USTINNABI UNION 76 #1 S101588973 TC5646263.2s Page 16 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 2860 N SANTIAGO BLVDMailing Address: Not reportedMailing Name: 7147615426Telephone: VICTOR HASSANContact: CAL000330484GEPAID: 2017Year: H&S 16Site Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Other organic solidsCat Decode: 0.0625Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other organic solidsWaste Category: Los AngelesTSD County: CAD028409019TSD EPA ID: OrangeGen County: ORANGE, CA 928670000Mailing City,St,Zip: 2860 N SANTIAGO BLVDMailing Address: Not reportedMailing Name: 7147615426Telephone: VICTOR HASSANContact: CAL000330484GEPAID: 2017Year: H&S 16Site Name: HAZNET: ActiveStatus: Not reportedComments: Not reportedEPA ID: Not reportedNPDES Number: Not reportedDUNs Number: Not reportedContact Phone: Not reportedContact: LOS ALAMITOS 90720Mailing City,St,Zip: Not reportedMailing Address 2: 911 WILSHIRE BLVD STE 10Mailing Address: Not reportedMail To: 2135960153Facility Phone: Not reportedSIC Code: Not reportedCortese Code: Not reportedRegulated ID: UTNKARegulated By: 30000665Facility ID: CA FID UST: Not reportedNumber Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 12000Capacity: ATank Status: 30-000-000136-000002SWRCB Tank Id: INNABI UNION 76 #1 (Continued)S101588973 TC5646263.2s Page 17 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedMailing Name: 7147615426Telephone: ALAEDDIN HASSANContact: CAL000330484GEPAID: 2015Year: H&S 16Site Name: OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.22935Tons: Treatment) Discharge To Sewer/Potw Or Npdes(With Prior Storage--With Or WithoutDisposal Method: Tank bottom wasteWaste Category: Los AngelesTSD County: CAD028409019TSD EPA ID: OrangeGen County: ORANGE, CA 928670000Mailing City,St,Zip: 2860 N SANTIAGO BLVDMailing Address: Not reportedMailing Name: 7147615426Telephone: VICTOR HASSANContact: CAL000330484GEPAID: 2016Year: H&S 16Site Name: OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.0625Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other organic solidsWaste Category: Los AngelesTSD County: CAD028409019TSD EPA ID: OrangeGen County: ORANGE, CA 928670000Mailing City,St,Zip: 2860 N SANTIAGO BLVDMailing Address: Not reportedMailing Name: 7147615426Telephone: VICTOR HASSANContact: CAL000330484GEPAID: 2016Year: H&S 16Site Name: OrangeFacility County: Treatment) Discharge To Sewer/Potw Or Npdes(With Prior Storage--With Or WithoutMethod Decode: Tank bottom wasteCat Decode: 0.1668Tons: Treatment) Discharge To Sewer/Potw Or Npdes(With Prior Storage--With Or WithoutDisposal Method: Tank bottom wasteWaste Category: Los AngelesTSD County: CAD028409019TSD EPA ID: OrangeGen County: ORANGE, CA 928670000Mailing City,St,Zip: INNABI UNION 76 #1 (Continued)S101588973 TC5646263.2s Page 18 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 083000585TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: HIST CORTESE: 2 additional CA_HAZNET: record(s) in the EDR Site Report. Click this hyperlink while viewing on your computer to access OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.1Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other organic solidsWaste Category: 99TSD County: AZR000501510TSD EPA ID: OrangeGen County: ORANGE, CA 928670000Mailing City,St,Zip: 2860 N SANTIAGO BLVDMailing Address: INNABI UNION 76 #1 (Continued)S101588973 FA0051673Facility ID: ORANGE CO. UST: -118.042611Longitude: 33.8039889Latitude: ORANGE COUNTYPermitting Agency: 18767Facility ID: -118.04396Longitude: 33.80264Latitude: Orange County Environmental HealthPermitting Agency: Not reportedFacility ID: UST: 226 ft. Site 6 of 9 in cluster A 0.043 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5100 KATELLA AVE N/A A6 USTTOSCO #5680 U003942130 Not reportedOther Type: Gas StationFacility Type: 00000008023Facility ID: STATERegion: http://geotracker.waterboards.ca.gov/ustpdfs/pdf/000290CE.pdfURL: 000290CEFile Number: HIST UST: 226 ft. Site 7 of 9 in cluster A 0.043 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5100 KATELLA N/A A7 HIST USTSERVICE STATION 5511 U001565447 TC5646263.2s Page 19 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Click here for Geo Tracker PDF: Stock Inventor, Pressure TestLeak Detection: Not reportedContainer Construction Thickness: WASTE OILType of Fuel: WASTETank Used for: 00000280Tank Capacity: 1964Year Installed: 5511-4Container Num: 003Tank Num: Stock Inventor, Pressure TestLeak Detection: Not reportedContainer Construction Thickness: PREMIUMType of Fuel: PRODUCTTank Used for: 00009940Tank Capacity: 1964Year Installed: 5511-2Container Num: 002Tank Num: Stock Inventor, Pressure TestLeak Detection: Not reportedContainer Construction Thickness: UNLEADEDType of Fuel: PRODUCTTank Used for: 00009940Tank Capacity: 1964Year Installed: 5511-1Container Num: 001Tank Num: 0003Total Tanks: LOS ANGELES, CA 90010Owner City,St,Zip: 3701 WILSHIRE BOULEVARD-SUITEOwner Address: UNION OIL COMPANY OF CALIFORNIOwner Name: 7145964360Telephone: ROBERT HENRY BARKERContact Name: SERVICE STATION 5511 (Continued) U001565447 Large Quantity GeneratorClassification: Not reportedEPA Region: Not reportedContact email: 714-428-6572Contact telephone: USContact country: Not reported Not reportedContact address: STEVE BOYDContact: PHOENIX, AZ 85072 PO BOX 52085Mailing address: CAL000169176EPA ID: LOS ALAMITOS, CA 90720 5100 KATELLAFacility address: Not reportedFacility name: 02/02/2002Date form received by agency: RCRA-LQG: 226 ft. Site 8 of 9 in cluster A 0.043 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SW 5100 KATELLA CAL000169176 A8 RCRA-LQG 1007200349 TC5646263.2s Page 20 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: 100 kg of that material at any time hazardous waste during any calendar month, and accumulates more than from the cleanup of a spill, into or on any land or water, of acutely of any residue or contaminated soil, waste or other debris resulting kg of acutely hazardous waste at any time; or generates 100 kg or less hazardous waste during any calendar month, and accumulates more than 1 waste during any calendar month; or generates 1 kg or less of acutely cleanup of a spill, into or on any land or water, of acutely hazardous residue or contaminated soil, waste or other debris resulting from the during any calendar month; or generates more than 100 kg of any calendar month; or generates more than 1 kg of acutely hazardous waste Handler: generates 1,000 kg or more of hazardous waste during anyDescription: (Continued)1007200349 LOS ALAMITOS, CA 90720 5300 KATELLA AVEOwner/operator address: TILOS EUROPEAN AUTOHAUSOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: Not reportedContact email: 562-799-8456Contact telephone: USContact country: LOS ALAMITOS, CA 90720 5300 KATELLA AVEContact address: DEANNA BURNSContact: CAR000078394EPA ID: LOS ALAMITOS, CA 90720 5300 KATELLA AVEFacility address: TILOS EUROPEAN AUTOHAUSFacility name: 08/17/2001Date form received by agency: RCRA NonGen / NLR: 266 ft. 0.050 mi.HAZNET Relative: Higher Actual: 32 ft. < 1/8 ECHOLOS ALAMITOS, CA 90720 SE FINDS5300 KATELLA AVE CAR000078394 9 RCRA NonGen / NLRTILOS EUROPEAN AUTOHAUS 1004675889 TC5646263.2s Page 21 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 2001Year: TILOS EUROPEAN AUTOHAUSSite Name: HAZNET: http://echo.epa.gov/detailed-facility-report?fid=110006486873DFR URL: 110006486873Registry ID: 1004675889Envid: ECHO: additional FINDS: detail in the EDR Site Report. Click this hyperlink while viewing on your computer to access corrective action activities required under RCRA. program staff to track the notification, permit, compliance, and and treat, store, or dispose of hazardous waste. RCRAInfo allows RCRA events and activities related to facilities that generate, transport, Conservation and Recovery Act (RCRA) program through the tracking of RCRAInfo is a national information system that supports the Resource Environmental Interest/Information System 110006486873Registry ID: FINDS: No violations foundViolation Status: CORROSIVE WASTE. Waste name: D002. Waste code: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-799-0021Owner/operator telephone: Not reportedOwner/operator country: TILOS EUROPEAN AUTOHAUS (Continued) 1004675889 TC5646263.2s Page 22 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 1.35Tons: RecyclerDisposal Method: Oil/water separation sludgeWaste Category: Not reportedTSD County: CAT080013352TSD EPA ID: Not reportedGen County: LOS ALAMITOS, CA 907200000Mailing City,St,Zip: 5300 KATELLA AVEMailing Address: Not reportedMailing Name: 5627990021Telephone: --Contact: CAR000078394GEPAID: TILOS EUROPEAN AUTOHAUS (Continued) 1004675889 Not reportedFacility Addr2: 06/30/2012Inactive Date: NoFacility Active: 08/20/2009Create Date: Power Laundries, Family and CommercialSIC Description: 7211SIC Code: Drycleaning and Laundry Services (except Coin-Operated)NAICS Description: 81232NAICS Code: CAL000345982EPA Id: 4Region Code: 0000000000Owner Fax: 907202802Mailing Zip: CAMailing State: LOS ALAMITOSMailing City: Not reportedMailing Address 2: 5074 KATELLA AVEMailing Address 1: Not reportedMailing Name: 5624301822Contact Telephone: Not reportedContact Address 2: 5074 KATELLA AVEContact Address: TONY TRANContact Name: 5624301822Owner Telephone: Not reportedOwner Address 2: 5074 KATELLA AVEOwner Address: DANA TRANOwner Name: Not reportedFacility Addr2: 06/30/2009Inactive Date: NoFacility Active: 04/08/2003Create Date: Power Laundries, Family and CommercialSIC Description: 7211SIC Code: Drycleaning and Laundry Services (except Coin-Operated)NAICS Description: 81232NAICS Code: CAL000268799EPA Id: DRYCLEANERS: 407 ft. Site 1 of 10 in cluster B 0.077 mi. Relative: Lower Actual: 30 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 5074 KATELLA AVE N/A B10 DRYCLEANERSRACER CLEANERS S106077058 TC5646263.2s Page 23 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING,DRY-TO-DRY NV,W/ SIC,PERCBCAT Description: 000603BCAT Number: INACTIVEPermit Status: 562 4301822Representative Telephone: TONY CHINH TRANRepresentative Name: AStatus: F88074Permit Number: 465427Application Number: 134245Facility ID: 0UTM North: 0UTM East: Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING,DRY-TO-DRY NV,W/ SIC,PERCBCAT Description: 000603BCAT Number: Not reportedPermit Status: 562 4301822Representative Telephone: TONY CHINH TRANRepresentative Name: AStatus: Not reportedPermit Number: 456997Application Number: 134245Facility ID: 0UTM North: 0UTM East: Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING,DRY-TO-DRY NV,W/ SIC,PERCBCAT Description: 000603BCAT Number: INACTIVEPermit Status: 562 4301822Representative Telephone: TONY CHINH TRANRepresentative Name: AStatus: F56254Permit Number: 407673Application Number: 134245Facility ID: DRYCLEAN SOUTH COAST: 4Region Code: 0000000000Owner Fax: 907202802Mailing Zip: CAMailing State: LOS ALAMITOSMailing City: Not reportedMailing Address 2: 5074 KATELLA AVEMailing Address 1: Not reportedMailing Name: 5624301822Contact Telephone: Not reportedContact Address 2: 5851 CROCUS CIRContact Address: THANH PHAMContact Name: 7148210998Owner Telephone: Not reportedOwner Address 2: 5851 CROCUS CIROwner Address: THANH HUY PHAMOwner Name: RACER CLEANERS (Continued)S106077058 TC5646263.2s Page 24 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0UTM North: 0UTM East: RACER CLEANERS (Continued)S106077058 Drycleaning Plants, Except Rugs, NEC2014 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2013 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2012 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2011 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2010 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2009 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2008 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2007 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2006 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2005 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2004 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2003 RACER DRY CLEANERS Drycleaning Plants, Except Rugs, NEC2002 RACER DRY CLEANERS Drycleaning Plants, Except Rugs2001 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs, NEC2001 RACER DRY CLEANERS Drycleaning Plants, Except Rugs2000 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1999 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1998 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1997 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1996 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1995 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1994 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1993 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1992 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1991 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1990 ALAMITOS CLEANERS AND LAUNDRY Drycleaning Plants, Except Rugs1989 ALAMITOS CLEANERS AND LAUNDRY Repair Services, NEC1988 ALAMITOS DRY CLEAN & LANDRY Repair Services, NEC1987 ALAMITOS DRY CLEAN & LANDRY Type:Year: Name: EDR Hist Cleaner 407 ft. Site 2 of 10 in cluster B 0.077 mi. Relative: Lower Actual: 30 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 5074 KATELLA AV N/A B11 EDR Hist CleanerALAMITOS CLEANERS AND LAUNDRY 1018665851 INACTIVEPermit Status: 213 5965020Representative Telephone: LEONARD KAFTONRepresentative Name: SStatus: M47067Permit Number: 132659Application Number: 47641Facility ID: DRYCLEAN SOUTH COAST: 407 ft. Site 3 of 10 in cluster B 0.077 mi. Relative: Lower Actual: 30 ft. < 1/8 LOS ALAMITOS, CA WSW 5074 KATELLA AVE N/A B12 DRYCLEANERSALAMITOS CLEANERS S121698047 TC5646263.2s Page 25 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0UTM North: 0UTM East: Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING EQUIP PERCHLOROETHYLENEBCAT Description: 000234BCAT Number: ALAMITOS CLEANERS (Continued)S121698047 0UTM North: 0UTM East: Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING, DRY-TO-DRY NON-VENT, PERCBCAT Description: 000601BCAT Number: Not reportedPermit Status: 562 4301822Representative Telephone: RICHARD HATTENRepresentative Name: AStatus: Not reportedPermit Number: 338739Application Number: 115287Facility ID: DRYCLEAN SOUTH COAST: 407 ft. Site 4 of 10 in cluster B 0.077 mi. Relative: Lower Actual: 30 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 5074 KATELLA AVE N/A B13 DRYCLEANERSALAMITOS LAUNDRY & DRY CLEANERS S121694087 0UTM North: 0UTM East: Not reportedCCAT Description: Not reportedCCAT Number: DRY CLEANING EQUIP PERCHLOROETHYLENEBCAT Description: 000234BCAT Number: Not reportedPermit Status: 213 4300096Representative Telephone: JOHN E ROBINSONRepresentative Name: IStatus: Not reportedPermit Number: 154924Application Number: 56429Facility ID: DRYCLEAN SOUTH COAST: 407 ft. Site 5 of 10 in cluster B 0.077 mi. Relative: Lower Actual: 30 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 5074-78 KATELLA AVE N/A B14 DRYCLEANERSALAMITOS CLEANERS S121698556 TC5646263.2s Page 26 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Garment Pressing And Cleaners’ Agents2014 DUTCH BOY DRY CLEANERS Type:Year: Name: EDR Hist Cleaner 409 ft. Site 9 of 9 in cluster A 0.077 mi. Relative: Higher Actual: 32 ft. < 1/8 LOS ALAMITOS, CA 90720 SSW 5131 ANTIETAM AVE N/A A15 EDR Hist CleanerDUTCH BOY DRY CLEANERS 1018886365 Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: NOT REQUIREDOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: KRIRK HONGPANICHOwner/operator name: Owner/Operator Summary: hazardous waste at any time waste during any calendar month, and accumulates more than 1000 kg of hazardous waste at any time; or generates 100 kg or less of hazardous waste during any calendar month and accumulates less than 6000 kg of Handler: generates more than 100 and less than 1000 kg of hazardousDescription: Small Small Quantity GeneratorClassification: 09EPA Region: Not reportedContact email: 213-594-8925Contact telephone: USContact country: LOS ALAMITOS, CA 90720 11061 WINNERS CIRCLEContact address: ENVIRONMENTAL MANAGERContact: LOS ALAMITOS, CA 90720 WINNERS CIRCLEMailing address: CAD981445026EPA ID: LOS ALAMITOS, CA 90720 11061 WINNERS CIRCLEFacility address: K & A IMPORT SERVICESFacility name: 09/15/1986Date form received by agency: RCRA-SQG: 496 ft. Site 1 of 3 in cluster C 0.094 mi. Relative: Lower Actual: 31 ft. < 1/8 ECHOLOS ALAMITOS, CA 90720 SSE FINDS11061 WINNERS CIRCLE CAD981445026 C16 RCRA-SQGK & A IMPORT SERVICES 1000101121 TC5646263.2s Page 27 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation http://echo.epa.gov/detailed-facility-report?fid=110002707928DFR URL: 110002707928Registry ID: 1000101121Envid: ECHO: additional FINDS: detail in the EDR Site Report. Click this hyperlink while viewing on your computer to access corrective action activities required under RCRA. program staff to track the notification, permit, compliance, and and treat, store, or dispose of hazardous waste. RCRAInfo allows RCRA events and activities related to facilities that generate, transport, Conservation and Recovery Act (RCRA) program through the tracking of RCRAInfo is a national information system that supports the Resource Environmental Interest/Information System 110002707928Registry ID: FINDS: No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: K & A IMPORT SERVICES (Continued) 1000101121 11061 WINNER CIRCLEFacility address: K&A IMPORTSFacility name: 09/10/1986Date form received by agency: RCRA-SQG: 496 ft. Site 2 of 3 in cluster C 0.094 mi. Relative: Lower Actual: 31 ft. < 1/8 LOS ALAMITOS, CA 90720 SSE HAZNET11061 WINNER CIRCLE CAD981443161 C17 RCRA-SQGK&A IMPORTS 1000118632 TC5646263.2s Page 28 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: KIRK HONGPAHICHOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: NOT REQUIREDOwner/operator name: Owner/Operator Summary: hazardous waste at any time waste during any calendar month, and accumulates more than 1000 kg of hazardous waste at any time; or generates 100 kg or less of hazardous waste during any calendar month and accumulates less than 6000 kg of Handler: generates more than 100 and less than 1000 kg of hazardousDescription: Small Small Quantity GeneratorClassification: 09EPA Region: Not reportedContact email: 213-594-8925Contact telephone: USContact country: LOS ALAMITOS, CA 90720 11061 WINNER CIRCLEContact address: ENVIRONMENTAL MANAGERContact: LOS ALAMITOS, CA 90720 WINNER CIRCLEMailing address: CAD981443161EPA ID: LOS ALAMITOS, CA 90720 K&A IMPORTS (Continued)1000118632 TC5646263.2s Page 29 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.91739999999Tons: RecyclerDisposal Method: Unspecified organic liquid mixtureWaste Category: Not reportedTSD County: CAD099452708TSD EPA ID: Not reportedGen County: LOS ALAMITOS, CA 907200000Mailing City,St,Zip: 11061 WINNER CIRCLEMailing Address: Not reportedMailing Name: 0000000000Telephone: Not reportedContact: CAD981443161GEPAID: 1993Year: K&A IMPORTSSite Name: HAZNET: No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: K&A IMPORTS (Continued)1000118632 hazardous waste at any time waste during any calendar month, and accumulates more than 1000 kg of hazardous waste at any time; or generates 100 kg or less of hazardous waste during any calendar month and accumulates less than 6000 kg of Handler: generates more than 100 and less than 1000 kg of hazardousDescription: Small Small Quantity GeneratorClassification: 09EPA Region: Not reportedContact email: 213-598-5895Contact telephone: USContact country: LOS ALAMITOS, CA 90720 4961 E KATELLAContact address: ENVIRONMENTAL MANAGERContact: CAD981684483EPA ID: LOS ALAMITOS, CA 90720 4961 E KATELLAFacility address: LOS ALAMITOS RACE TRACKFacility name: 10/20/1986Date form received by agency: RCRA-SQG: CIWQS HIST CORTESE HAZNET ECHO FINDS 549 ft.Orange Co. Industrial SiteSite 6 of 10 in cluster B 0.104 mi.CA FID UST Relative: Lower Actual: 31 ft. < 1/8 SWEEPS USTLOS ALAMITOS, CA 90720 WSW LUST4961 E KATELLA CAD981684483 B18 RCRA-SQGLOS ALAMITOS RACE TRACK 1000101555 TC5646263.2s Page 30 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedAbate Method: 0Qty Leaked: GasolineSubstance: Other ground water affectedCase Type: 88UT153Local Case Num: 083001061TCase Number: Case ClosedFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: NOT REQUIREDOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 415-555-1212Owner/operator telephone: Not reportedOwner/operator country: NOT REQUIRED, ME 99999 NOT REQUIREDOwner/operator address: HOLLYWOOD PARK OPEROwner/operator name: Owner/Operator Summary: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 31 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedAbate Method: 0Qty Leaked: GasolineSubstance: Soil onlyCase Type: 97UT016Local Case Num: 083003034TCase Number: Case ClosedFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: SSStaff Initials: NOMStaff: *MTBE Class: Site NOT Tested for MTBE.Includes Unknown and Not Analyzed.MTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 0MTBE Concentration: Not reportedMax MTBE GW: Not reportedMTBE Date: -118.0466934Longitude: 33.8029319Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: Not reportedGW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: Not reportedDate Remedial Action Underway: Not reportedDate Remediation Plan Submitted: Not reportedDate Pollution Characterization Began: Not reportedDate Prelim Assessment Workplan Submitted: 6/26/1996Close Date: Not reportedEnforcement Date: 8/9/1988Discover Date: Not reportedDate Preliminary Assessment Began: Not reportedDate Confirmation of Leak Began: Not reportedEnter Date: 9/9/9999How Stopped Date: T0605900836Global ID: UnknownLeak Source: UnknownLeak Cause: Close TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: Not reportedEnf Type: Not reportedCross Street: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 32 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 30-000-005314-000006SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: Not reportedBoard Of Equalization: Not reportedNumber: 5314Comp Number: Not reportedStatus: SWEEPS UST: Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: SSStaff Initials: NOMStaff: *MTBE Class: Site NOT Tested for MTBE.Includes Unknown and Not Analyzed.MTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 0MTBE Concentration: Not reportedMax MTBE GW: Not reportedMTBE Date: -118.0466934Longitude: 33.8029319Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: Not reportedGW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: Not reportedDate Remedial Action Underway: Not reportedDate Remediation Plan Submitted: Not reportedDate Pollution Characterization Began: Not reportedDate Prelim Assessment Workplan Submitted: 7/29/1997Close Date: Not reportedEnforcement Date: 6/23/1997Discover Date: Not reportedDate Preliminary Assessment Began: Not reportedDate Confirmation of Leak Began: Not reportedEnter Date: 9/9/9999How Stopped Date: T0605902069Global ID: UnknownLeak Source: UnknownLeak Cause: Close TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: Not reportedEnf Type: Not reportedCross Street: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 33 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 1000Capacity: Not reportedTank Status: 30-000-005314-000009SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: Not reportedBoard Of Equalization: Not reportedNumber: 5314Comp Number: Not reportedStatus: Not reportedNumber Of Tanks: Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 1500Capacity: Not reportedTank Status: 30-000-005314-000008SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: Not reportedBoard Of Equalization: Not reportedNumber: 5314Comp Number: Not reportedStatus: Not reportedNumber Of Tanks: Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 1500Capacity: Not reportedTank Status: 30-000-005314-000007SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: Not reportedBoard Of Equalization: Not reportedNumber: 5314Comp Number: Not reportedStatus: Not reportedNumber Of Tanks: Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 10000Capacity: Not reportedTank Status: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 34 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedBoard Of Equalization: 9Number: 5314Comp Number: ActiveStatus: Not reportedNumber Of Tanks: DIESELContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 10000Capacity: ATank Status: 30-000-005314-000012SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 5314Comp Number: ActiveStatus: 3Number Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 5000Capacity: ATank Status: 30-000-005314-000011SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 5314Comp Number: ActiveStatus: Not reportedNumber Of Tanks: Not reportedContent: PRODUCTSTG: UNKNOWNTank Use: Not reportedActive Date: 2000Capacity: Not reportedTank Status: 30-000-005314-000010SWRCB Tank Id: Not reportedOwner Tank Id: Not reportedCreated Date: Not reportedAction Date: Not reportedReferral Date: Not reportedBoard Of Equalization: Not reportedNumber: 5314Comp Number: Not reportedStatus: Not reportedNumber Of Tanks: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 35 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation limits on what can be discharged, impose monitoring and reporting States are required to obtain a permit. The permit will likely contain discharge pollutants from any point source into waters of the United issued under the Clean Water Act. Under NPDES, all facilities that the Compliance Information System (ICIS) tracks surface water permits US National Pollutant Discharge Elimination System (NPDES) module of and settlements. regions and states with cooperative agreements, enforcement actions, Toxic Substances Control Act (TSCA). The system tracks inspections in Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) and the NCDB (National Compliance Data Base) supports implementation of the Environmental Interest/Information System 110002751683Registry ID: FINDS: DATA NOT ENTERED, SEE FILEReleased Chemical: Closed pre 1994, file review required to determine closure typeClosure Type: CLOSED 2/5/1990Current Status: RO0000192Record ID: 89IC018Case ID: Orange Co. Industrial Site: ActiveStatus: Not reportedComments: Not reportedEPA ID: Not reportedNPDES Number: Not reportedDUNs Number: Not reportedContact Phone: Not reportedContact: LOS ALAMITOS 90720Mailing City,St,Zip: Not reportedMailing Address 2: 4961 KATELLA ATTN: LEONARMailing Address: Not reportedMail To: 7149951234Facility Phone: Not reportedSIC Code: Not reportedCortese Code: Not reportedRegulated ID: UTNKARegulated By: 30000858Facility ID: CA FID UST: Not reportedNumber Of Tanks: LEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 5000Capacity: ATank Status: 30-000-005314-000013SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 36 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedMethod Decode: Not reportedCat Decode: .0625Tons: Transfer StationDisposal Method: Aqueous solution with total organic residues less than 10 percentWaste Category: Not reportedTSD County: CAT000613893TSD EPA ID: Not reportedGen County: LOS ALAMITOS, CA 907200000Mailing City,St,Zip: 4961 E KATELLAMailing Address: Not reportedMailing Name: 0000000000Telephone: Not reportedContact: CAD981684483GEPAID: 1998Year: LOS ALAMITOS RACE TRACKSite Name: OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.32Tons: Transfer StationDisposal Method: Aqueous solution with total organic residues less than 10 percentWaste Category: Not reportedTSD County: CAT000613893TSD EPA ID: Not reportedGen County: LOS ALAMITOS, CA 907200000Mailing City,St,Zip: 4961 E KATELLAMailing Address: Not reportedMailing Name: 7148202800Telephone: FRANK SHERREN FACILITY MANAGERContact: CAD981684483GEPAID: 2001Year: LOS ALAMITOS RACE TRACKSite Name: HAZNET: http://echo.epa.gov/detailed-facility-report?fid=110002751683DFR URL: 110002751683Registry ID: 1000101555Envid: ECHO: additional FINDS: detail in the EDR Site Report. Click this hyperlink while viewing on your computer to access STATE MASTER corrective action activities required under RCRA. program staff to track the notification, permit, compliance, and and treat, store, or dispose of hazardous waste. RCRAInfo allows RCRA events and activities related to facilities that generate, transport, Conservation and Recovery Act (RCRA) program through the tracking of RCRAInfo is a national information system that supports the Resource discharge does not adversely affect water quality. requirements, and include other provisions to ensure that the LOS ALAMITOS RACE TRACK (Continued) 1000101555 TC5646263.2s Page 37 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation -118.044244Longitude: 33.80311Latitude: 8Violations within 5 years: 2Enforcement Actions within 5 years: 3TTWQ: CComplexity: MinorMajor/Minor: 0.0065Design Flow: 07/31/2020Expiration/Review Date: Not reportedTermination Date: 08/01/2015Effective Date: 07/24/2015Adoption Date: CA0106348NPDES Number: 8 301432001WDID: R8-2015-0002Order Number: NPDES PermitRegulatory Measure Type: ActiveRegulatory Measure Status: ANIWSTOTH, NPDESWWProgram: 8Region: 7948SIC/NAICS: Service/Commercial Site, NECPlace/Project Type: 4961 Katella Avenue, Los Alamitos, CA 90720Agency Address: Los Alamitos Race CourseAgency: CIWQS: 083003034TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: HIST CORTESE: OrangeFacility County: LOS ALAMITOS RACE TRACK (Continued) 1000101555 Not reportedOwner State: Not reportedOwner Mail Address: Not reportedOwner Phone: Not reportedOperator Phone: Not reportedOperator Name: Not reportedMailing Address Zip Code: Not reportedMailing Address State: Not reportedMailing Address City: Not reportedMailing Address: Not reportedFax: Not reportedPhone: Not reportedBusiness Name: Not reportedFacility ID: Not reportedCERSID: 1,320Total Gallons: LOS ALAMITOS RACE COURSEOwner: OrangeCertified Unified Program Agencies: AST: 549 ft. Site 7 of 10 in cluster B 0.104 mi. Relative: Lower Actual: 31 ft. < 1/8 LOS ALAMITOS, CA WSW 4961 KATELLA AVE N/A B19 AST A100340703 TC5646263.2s Page 38 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedEPAID: Not reportedProperty Owner Country: Not reportedProperty Owner Zip Code: Not reportedProperty Owner Stat : Not reportedProperty Owner City: Not reportedProperty Owner Mailing Address: Not reportedProperty Owner Phone: Not reportedProperty Owner Name: Not reportedOwner Country: Not reportedOwner Zip Code: (Continued)A100340703 06/30/1997Date: OtherAction Type: T0605902069Global Id: LUST: Not reportedPhone Number: nolson-martin@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: NANCY OLSON-MARTINContact Name: Regional Board CaseworkerContact Type: T0605902069Global Id: 7144336261Phone Number: klambert@ochca.comEmail: SANTA ANACity: 1241 E DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: KEVIN LAMBERTContact Name: Local Agency CaseworkerContact Type: T0605902069Global Id: LUST: Not reportedSite History: GasolinePotential Contaminants of Concern: SoilPotential Media Affect: 97UT016Local Case Number: Local AgencyFile Location: ORANGE COUNTY LOPLocal Agency: 083003034TRB Case Number: KLCase Worker: 07/29/1997Status Date: Completed - Case ClosedStatus: -118.04396Longitude: 33.807404Latitude: T0605902069Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605902069Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: LUST: 549 ft.CIWQSSite 8 of 10 in cluster B 0.104 mi.NPDES Relative: Lower Actual: 31 ft. < 1/8 HIST CORTESELOS ALAMITOS, CA 90720 WSW ENF4961 KATELLA N/A B20 LUSTLOS ALAMITOS RACE COURSE S100723265 TC5646263.2s Page 39 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedPhone Number: nolson-martin@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: NANCY OLSON-MARTINContact Name: Regional Board CaseworkerContact Type: T0605900836Global Id: 7144336261Phone Number: klambert@ochca.comEmail: SANTA ANACity: 1241 E DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: KEVIN LAMBERTContact Name: Local Agency CaseworkerContact Type: T0605900836Global Id: LUST: Not reportedSite History: GasolinePotential Contaminants of Concern: Other Groundwater (uses other than drinking water)Potential Media Affect: 88UT153Local Case Number: Local AgencyFile Location: ORANGE COUNTY LOPLocal Agency: 083001061TRB Case Number: KLCase Worker: 06/26/1996Status Date: Completed - Case ClosedStatus: -118.0466934Longitude: 33.8029319Latitude: T0605900836Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605900836Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: 06/23/1997Status Date: Open - Case Begin DateStatus: T0605902069Global Id: 07/29/1997Status Date: Completed - Case ClosedStatus: T0605902069Global Id: LUST: Leak DiscoveryAction: 06/23/1997Date: OtherAction Type: T0605902069Global Id: Closure/No Further Action LetterAction: 07/29/1997Date: ENFORCEMENTAction Type: T0605902069Global Id: Leak ReportedAction: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 40 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation -118.044244Place Longitude: 33.80311Place Latitude: 1# Of Agencies: Privately-Owned BusinessAgency Type: IndustrialFacility Type: Service/Commercial Site, NECPlace Subtype: Service/CommercialPlace Type: Los Alamitos Race CourseAgency Name: 259101Facility Id: 8Region: ENF: RO0001369Record ID: 07/29/1997Date Closed: Gasoline-Automotive (motor gasoline and additives), leaded & unleadedReleased Substance: 97UT016Facility Id: ORANGERegion: RO0002572Record ID: 06/26/1996Date Closed: Gasoline-Automotive (motor gasoline and additives), leaded & unleadedReleased Substance: 88UT153Facility Id: ORANGERegion: ORANGE CO. LUST: 08/09/1988Status Date: Open - Case Begin DateStatus: T0605900836Global Id: 06/26/1996Status Date: Completed - Case ClosedStatus: T0605900836Global Id: LUST: Leak DiscoveryAction: 08/09/1988Date: OtherAction Type: T0605900836Global Id: Closure/No Further Action LetterAction: 06/26/1996Date: ENFORCEMENTAction Type: T0605900836Global Id: CorrespondenceAction: 04/06/1992Date: RESPONSEAction Type: T0605900836Global Id: Leak ReportedAction: 08/09/1988Date: OtherAction Type: T0605900836Global Id: LUST: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 41 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Admin Civil LiabilityEnforcement Action Type: R8-2014-0080Order / Resolution Number: 8Region: 399232Enforcement Id(EID): PassiveDirection/Voice: 66 - NPDES Based on FlowFee Code: IIndividual/General: NStatus Enrollee: Not reportedWDR Review - Planned: Not reportedWDR Review - Pending: Not reportedWDR Review - No Action Required: Not reportedWDR Review - Rescind: Not reportedWDR Review - Revise/Renew: Not reportedWDR Review - Amend: 07/31/2015Termination Date: 03/01/2014Expiration/Review Date: 03/27/2009Effective Date: 08/06/2015Status Date: HistoricalStatus: Not reportedApplication Fee Amt Received: N301H: Not reportedDredge Fill Fee: N - NoReclamation: OTHNpdes Type: MinorMajor-Minor: CA0106348Npdes# CA#: R8-2009-0017Order #: 8Region: NPDES PermitsReg Measure Type: 364287Reg Measure Id: 8 301432001WDID: 1# Of Programs: ANIMALWASTEProgram Category2: ANIMALWASTEProgram Category1: ANIWSTOTHProgram: Not reportedFacility Waste Type 4: Not reportedFacility Waste Type 3: Not reportedFacility Waste Type 2: Stormwater runoffFacility Waste Type: X - Facility is not a POTWPretreatment: CComplexity: 3Threat To Water Quality: 6.49999999Design Flow: Reg MeasSource Of Facility: 1# Of Places: Not reportedNAICS Desc 3: Not reportedNAICS Code 3: Not reportedNAICS Desc 2: Not reportedNAICS Code 2: Not reportedNAICS Desc 1: Not reportedNAICS Code 1: Not reportedSIC Desc 3: Not reportedSIC Code 3: Not reportedSIC Desc 2: Not reportedSIC Code 2: Racing, Including Track OperationsSIC Desc 1: 7948SIC Code 1: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 42 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 1# Of Programs: ANIMALWASTEProgram Category2: ANIMALWASTEProgram Category1: ANIWSTOTHProgram: Not reportedFacility Waste Type 4: Not reportedFacility Waste Type 3: Not reportedFacility Waste Type 2: Stormwater runoffFacility Waste Type: X - Facility is not a POTWPretreatment: CComplexity: 3Threat To Water Quality: 6.49999999Design Flow: Reg MeasSource Of Facility: 1# Of Places: Not reportedNAICS Desc 3: Not reportedNAICS Code 3: Not reportedNAICS Desc 2: Not reportedNAICS Code 2: Not reportedNAICS Desc 1: Not reportedNAICS Code 1: Not reportedSIC Desc 3: Not reportedSIC Code 3: Not reportedSIC Desc 2: Not reportedSIC Code 2: Racing, Including Track OperationsSIC Desc 1: 7948SIC Code 1: -118.044244Place Longitude: 33.80311Place Latitude: 1# Of Agencies: Privately-Owned BusinessAgency Type: IndustrialFacility Type: Service/Commercial Site, NECPlace Subtype: Service/CommercialPlace Type: Los Alamitos Race CourseAgency Name: 259101Facility Id: 8Region: 9890Total $ Paid/Completed Amount: 0Project $ Completed: 9890Liability $ Paid: 0Project $ Amount: 9890Liability $ Amount: 9890Initial Assessed Amount: 9890Total Assessment Amount: 1# Of Programs1: 2015-01-30Latest Milestone Completion Date: ANIWSTOTHProgram: non-stormwater unauthorized discharge. Enforcement action towards Discharger is due to aDescription: ACL R8-2014-0080 for Los Alamitos Race CourseTitle: HistoricalStatus: Not reportedEPL Issuance Date: Not reportedACL Issuance Date: 01/30/2015Termination Date: Not reportedAchieve Date: 12/22/2014Adoption/Issuance Date: 12/22/2014Effective Date: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 43 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 083001061TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: HIST CORTESE: 0Total $ Paid/Completed Amount: 0Project $ Completed: 0Liability $ Paid: 0Project $ Amount: 0Liability $ Amount: 0Initial Assessed Amount: 0Total Assessment Amount: 1# Of Programs1: Not reportedLatest Milestone Completion Date: ANIWSTOTHProgram: Not reportedDescription: SEL 09/24/2014 for Los Alamitos Race CourseTitle: ActiveStatus: Not reportedEPL Issuance Date: Not reportedACL Issuance Date: Not reportedTermination Date: Not reportedAchieve Date: 09/24/2014Adoption/Issuance Date: 09/24/2014Effective Date: Staff Enforcement LetterEnforcement Action Type: Not reportedOrder / Resolution Number: 8Region: 398238Enforcement Id(EID): PassiveDirection/Voice: 66 - NPDES Based on FlowFee Code: IIndividual/General: NStatus Enrollee: Not reportedWDR Review - Planned: Not reportedWDR Review - Pending: Not reportedWDR Review - No Action Required: Not reportedWDR Review - Rescind: Not reportedWDR Review - Revise/Renew: Not reportedWDR Review - Amend: 07/31/2015Termination Date: 03/01/2014Expiration/Review Date: 03/27/2009Effective Date: 08/06/2015Status Date: HistoricalStatus: Not reportedApplication Fee Amt Received: N301H: Not reportedDredge Fill Fee: N - NoReclamation: OTHNpdes Type: MinorMajor-Minor: CA0106348Npdes# CA#: R8-2009-0017Order #: 8Region: NPDES PermitsReg Measure Type: 364287Reg Measure Id: 8 301432001WDID: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 44 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 714-820-2715Contact Phone: Facility ManagerContact Title: Frank SherrenContact: AcresPlace Size Unit: 38.9Place Size: 10/12/2015Status Date: TerminatedStatus: 02/09/2011Processed Date: 02/07/2011Received Date: Not reportedDischarge Zip: Not reportedDischarge State: Not reportedDischarge City: Not reportedDischarge Address: Not reportedDischarge Name: 09/02/2015Termination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: Not reportedEffective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: Not reportedProgram Type: 8 30C360370WDID: Not reportedPlace ID: ConstructionRegulatory Measure Type: Not reportedOrder Number: 411471Regulatory Measure ID: 8Region: Not reportedAgency Number: Not reportedStatus: Not reportedNPDES Number: NPDES as of 03/2018: 90720Operator Zip: CaliforniaOperator State: Los AlamitosOperator City: 4961Operator Address: Los alamitos Race CourseOperator Name: 10/12/2015Status Date: TerminatedStatus: Not reportedDischarge Zip: Not reportedDischarge State: Not reportedDischarge City: Not reportedDischarge Name: Not reportedDischarge Address: Not reportedExpiration Date Of Regulatory Measure: Not reportedTermination Date Of Regulatory Measure: Not reportedEffective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: Not reportedProgram Type: ConstructionRegulatory Measure Type: 8 30C360370WDID: Not reportedOrder Number: Not reportedPlace ID: Not reportedRegulatory Measure ID: Not reportedAgency Number: Not reportedRegion: Not reportedNPDES Number: Not reportedFacility Status: NPDES: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 45 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 8 30C360370WDID: Not reportedPlace ID: EnrolleeRegulatory Measure Type: 2009-0009-DWQOrder Number: 411471Regulatory Measure ID: 8Region: 0Agency Number: TerminatedStatus: CAS000002NPDES Number: Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: 07-FEB-11Certification Date: Facility ManagerCertifier Title: Frank SherrenCertifier: Not reportedReceiving Water Name: NDir Discharge Uswater Ind: Not reportedConstype Water Sewer Ind: Not reportedConstype Utility Ind: Not reportedConstype Utility Description: Not reportedConstype Transport Ind: Not reportedConstype Residential Ind: YConstype Recons Ind: YConstype Other Ind: institutionalConstype Other Description: Not reportedConstype Industrial Ind: Not reportedConstype Gas Line Ind: Not reportedConstype Electrical Line Ind: Not reportedConstype Commertial Ind: Not reportedConstype Comm Line Ind: Not reportedConstype Cable Line Ind: Not reportedConstype Below Ground Ind: Not reportedConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: NConstype Linear Utility Ind: Not reportedDeveloper Contact Title: Frank SherrenDeveloper Contact: 90720Developer Zip: CaliforniaDeveloper State: Los AlamitosDeveloper City: 4961 Katella AveDeveloper Address: Los alamitos Race CourseDeveloper: Private BusinessOperator Type: fsherren@losalamitos.comOperator Contact Email: Not reportedOperator Contact Phone Ext: 714-820-2800Operator Contact Phone: Not reportedOperator Contact Title: Frank SherrenOperator Contact: 90720Operator Zip: CaliforniaOperator State: Los AlamitosOperator City: 4961Operator Address: Los alamitos Race CourseOperator Name: fsherren@losalamitos.comContact Email: Not reportedContact Phone Ext: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 46 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedConstype Utility Ind: Not reportedConstype Utility Description: Not reportedConstype Transport Ind: Not reportedConstype Residential Ind: Not reportedConstype Recons Ind: Not reportedConstype Other Ind: Not reportedConstype Other Description: Not reportedConstype Industrial Ind: Not reportedConstype Gas Line Ind: Not reportedConstype Electrical Line Ind: Not reportedConstype Commertial Ind: Not reportedConstype Comm Line Ind: Not reportedConstype Cable Line Ind: Not reportedConstype Below Ground Ind: Not reportedConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: Not reportedConstype Linear Utility Ind: Not reportedDeveloper Contact Title: Not reportedDeveloper Contact: Not reportedDeveloper Zip: Not reportedDeveloper State: Not reportedDeveloper City: Not reportedDeveloper Address: Not reportedDeveloper: Not reportedOperator Type: Not reportedOperator Contact Email: Not reportedOperator Contact Phone Ext: Not reportedOperator Contact Phone: Not reportedOperator Contact Title: Not reportedOperator Contact: Not reportedOperator Zip: Not reportedOperator State: Not reportedOperator City: Not reportedOperator Address: Not reportedOperator Name: Not reportedContact Email: Not reportedContact Phone Ext: Not reportedContact Phone: Not reportedContact Title: Not reportedContact: Not reportedPlace Size Unit: Not reportedPlace Size: Not reportedStatus Date: Not reportedStatus: Not reportedProcessed Date: Not reportedReceived Date: 90720Discharge Zip: CaliforniaDischarge State: Los AlamitosDischarge City: 4961Discharge Address: Los alamitos Race CourseDischarge Name: 09/02/2015Termination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: 02/09/2011Effective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: ConstructionProgram Type: LOS ALAMITOS RACE COURSE (Continued) S100723265 TC5646263.2s Page 47 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation -118.050132Longitude: 33.807234Latitude: 0Violations within 5 years: 0Enforcement Actions within 5 years: Not reportedTTWQ: Not reportedComplexity: Not reportedMajor/Minor: Not reportedDesign Flow: Not reportedExpiration/Review Date: 09/02/2015Termination Date: 02/09/2011Effective Date: Not reportedAdoption Date: CAS000002NPDES Number: 8 30C360370WDID: 2009-0009-DWQOrder Number: Storm water constructionRegulatory Measure Type: TerminatedRegulatory Measure Status: CONSTWProgram: 8Region: Not reportedSIC/NAICS: Construction - Other: institutional, ReconstructionPlace/Project Type: 4961 Katella ave, Los Alamitos, CA 90720Agency Address: Los alamitos Race CourseAgency: CIWQS: Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: Not reportedCertification Date: Not reportedCertifier Title: Not reportedCertifier: Not reportedReceiving Water Name: Not reportedDir Discharge Uswater Ind: Not reportedConstype Water Sewer Ind: LOS ALAMITOS RACE COURSE (Continued) S100723265 Drycleaning Plants, Except Rugs, NEC2009 ISLAND CLEANERS Drycleaning Plants, Except Rugs, NEC2008 ISLAND CLEANERS Drycleaning Plants, Except Rugs, NEC2007 ISLAND CLEANERS Drycleaning Plants, Except Rugs, NEC2006 ISLAND CLEANERS Drycleaning Plants, Except Rugs, NEC2005 ISLAND CLEANERS Type:Year: Name: EDR Hist Cleaner 552 ft. Site 9 of 10 in cluster B 0.105 mi. Relative: Lower Actual: 31 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 4959 KATELLA AVE N/A B21 EDR Hist CleanerISLAND CLEANERS 1020010145 TC5646263.2s Page 48 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation NoUnderground injection activity: NoTreater, storer or disposer of HW: YesTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 561-438-7903Owner/operator telephone: Not reportedOwner/operator country: BOCA RATON, FL 33496 6600 N MILITARY TRAIL C456Owner/operator address: ANA FERNANDEZOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 561-438-4800Owner/operator telephone: Not reportedOwner/operator country: BOCA RATON, FL 33496 6600 N MILITARY TRAILOwner/operator address: OFFICE DEPOT INCOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: ANA.FERNANDEZ@OFFICEDEPOT.COMContact email: 561-438-7903Contact telephone: Not reportedContact country: BOCA RATON, FL 33496 6600 N MILITARY TRAIL C456Contact address: ANA FERNANDEZContact: BOCA RATON, FL 33496-0000 6600 N MILITARY TRAIL C456Mailing address: CAL000420839EPA ID: LOS ALAMITOS, CA 90720 4955 KATELLA AVEFacility address: OFFICE DEPOT 2281Facility name: 10/10/2016Date form received by agency: RCRA NonGen / NLR: 555 ft. Site 10 of 10 in cluster B 0.105 mi. Relative: Lower Actual: 31 ft. < 1/8 LOS ALAMITOS, CA 90720 WSW 4955 KATELLA AVE CAL000420839 B22 RCRA NonGen / NLROFFICE DEPOT 2281 1024856648 TC5646263.2s Page 49 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: OFFICE DEPOT 2281 (Continued)1024856648 03/22/2004Date: OtherAction Type: T0605997341Global Id: LUST: 7144336251Phone Number: tescobedo@ochca.comEmail: SANTA ANACity: 1241 EAST DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: TAMARA ESCOBEDOContact Name: Local Agency CaseworkerContact Type: T0605997341Global Id: 9513206375Phone Number: rose.scott@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: ROSE SCOTTContact Name: Regional Board CaseworkerContact Type: T0605997341Global Id: LUST: Not reportedSite History: GasolinePotential Contaminants of Concern: Other Groundwater (uses other than drinking water)Potential Media Affect: 04UT011Local Case Number: Local Agency WarehouseFile Location: ORANGE COUNTY LOPLocal Agency: Not reportedRB Case Number: TECase Worker: 01/16/2007Status Date: Completed - Case ClosedStatus: -118.054133715Longitude: 33.809751502Latitude: T0605997341Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605997341Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: LUST: 566 ft. 0.107 mi. Relative: Lower Actual: 31 ft. < 1/8 CYPRESS, CA 90630 WNW NPDES4921 KATELLA N/A 23 LUSTCYPRESS GOLF CLUB S106387355 TC5646263.2s Page 50 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 01/16/2007Status Date: Completed - Case ClosedStatus: T0605997341Global Id: LUST: Staff LetterAction: 08/05/2004Date: ENFORCEMENTAction Type: T0605997341Global Id: Staff LetterAction: 05/09/2006Date: ENFORCEMENTAction Type: T0605997341Global Id: Leak StoppedAction: 03/02/2004Date: OtherAction Type: T0605997341Global Id: Closure/No Further Action LetterAction: 01/16/2007Date: ENFORCEMENTAction Type: T0605997341Global Id: Staff LetterAction: 08/19/2005Date: ENFORCEMENTAction Type: T0605997341Global Id: Staff LetterAction: 06/17/2005Date: ENFORCEMENTAction Type: T0605997341Global Id: Staff LetterAction: 05/14/2004Date: ENFORCEMENTAction Type: T0605997341Global Id: Notice of ResponsibilityAction: 03/22/2004Date: ENFORCEMENTAction Type: T0605997341Global Id: Staff LetterAction: 03/15/2006Date: ENFORCEMENTAction Type: T0605997341Global Id: Leak DiscoveryAction: 03/02/2004Date: OtherAction Type: T0605997341Global Id: Leak ReportedAction: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 51 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedDate Pollution Characterization Began: 4/27/2004Date Prelim Assessment Workplan Submitted: Not reportedClose Date: Not reportedEnforcement Date: 3/2/2004Discover Date: 6/11/2004Date Preliminary Assessment Began: 3/2/2004Date Confirmation of Leak Began: Not reportedEnter Date: 3/2/2004How Stopped Date: T0605997341Global ID: TankLeak Source: UnknownLeak Cause: Close TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: SELEnf Type: Not reportedCross Street: Not reportedAbate Method: 0Qty Leaked: GasolineSubstance: Other ground water affectedCase Type: 04UT011Local Case Num: Not reportedCase Number: Preliminary site assessment underwayFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: RO0003288Record ID: 01/16/2007Date Closed: Gasoline-Automotive (motor gasoline and additives), leaded & unleadedReleased Substance: 04UT011Facility Id: ORANGERegion: ORANGE CO. LUST: 03/31/2005Status Date: Open - Verification MonitoringStatus: T0605997341Global Id: 06/11/2004Status Date: Open - Site AssessmentStatus: T0605997341Global Id: 04/27/2004Status Date: Open - Site AssessmentStatus: T0605997341Global Id: 03/02/2004Status Date: Open - Site AssessmentStatus: T0605997341Global Id: 03/02/2004Status Date: Open - Case Begin DateStatus: T0605997341Global Id: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 52 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedOperator Zip: Not reportedOperator State: Not reportedOperator City: Not reportedOperator Address: Not reportedOperator Name: Not reportedStatus Date: Not reportedStatus: 92660Discharge Zip: CaliforniaDischarge State: Newport BeachDischarge City: William Lyon Home IncDischarge Name: 4695 MacArthur CourtDischarge Address: Not reportedExpiration Date Of Regulatory Measure: Not reportedTermination Date Of Regulatory Measure: 05/09/2017Effective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: ConstructionProgram Type: EnrolleeRegulatory Measure Type: 8 30C379769WDID: 2009-0009-DWQOrder Number: Not reportedPlace ID: 485988Regulatory Measure ID: 0Agency Number: 8Region: CAS000002NPDES Number: ActiveFacility Status: NPDES: Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: ARStaff Initials: Not reportedStaff: *MTBE Class: Site NOT Tested for MTBE.Includes Unknown and Not Analyzed.MTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 0MTBE Concentration: Not reportedMax MTBE GW: Not reportedMTBE Date: 0Longitude: 0Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: Not reportedGW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: Not reportedDate Remedial Action Underway: Not reportedDate Remediation Plan Submitted: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 53 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation YConstype Commertial Ind: NConstype Comm Line Ind: NConstype Cable Line Ind: NConstype Below Ground Ind: NConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: NConstype Linear Utility Ind: Offsite Construction ManagerDeveloper Contact Title: Bryan BergeronDeveloper Contact: 92660Developer Zip: CaliforniaDeveloper State: Newport BeachDeveloper City: 4695 MacArthur CourtDeveloper Address: William Lyon Home IncDeveloper: Private BusinessOperator Type: Bryan.Bergeron@LyonHomes.comOperator Contact Email: Not reportedOperator Contact Phone Ext: 949-476-5441Operator Contact Phone: Offsite Construction ManagerOperator Contact Title: Bryan BergeronOperator Contact: 92660Operator Zip: CaliforniaOperator State: Newport BeachOperator City: 4695 MacArthur CourtOperator Address: William Lyon Home IncOperator Name: Bryan.Bergeron@LyonHomes.comContact Email: Not reportedContact Phone Ext: 949-476-5441Contact Phone: Offsite Construction ManagerContact Title: Bryan BergeronContact: AcresPlace Size Unit: 32.92Place Size: 05/09/2017Status Date: ActiveStatus: 05/09/2017Processed Date: 05/04/2017Received Date: Not reportedDischarge Zip: Not reportedDischarge State: Not reportedDischarge City: Not reportedDischarge Address: Not reportedDischarge Name: Not reportedTermination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: Not reportedEffective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: Not reportedProgram Type: 8 30C379769WDID: Not reportedPlace ID: ConstructionRegulatory Measure Type: Not reportedOrder Number: 485988Regulatory Measure ID: 8Region: Not reportedAgency Number: Not reportedStatus: Not reportedNPDES Number: NPDES as of 03/2018: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 54 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedOperator Contact Title: Not reportedOperator Contact: Not reportedOperator Zip: Not reportedOperator State: Not reportedOperator City: Not reportedOperator Address: Not reportedOperator Name: Not reportedContact Email: Not reportedContact Phone Ext: Not reportedContact Phone: Not reportedContact Title: Not reportedContact: Not reportedPlace Size Unit: Not reportedPlace Size: Not reportedStatus Date: Not reportedStatus: Not reportedProcessed Date: Not reportedReceived Date: 92660Discharge Zip: CaliforniaDischarge State: Newport BeachDischarge City: 4695 MacArthur CourtDischarge Address: William Lyon Home IncDischarge Name: Not reportedTermination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: 05/09/2017Effective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: ConstructionProgram Type: 8 30C379769WDID: Not reportedPlace ID: EnrolleeRegulatory Measure Type: 2009-0009-DWQOrder Number: 485988Regulatory Measure ID: 8Region: 0Agency Number: ActiveStatus: CAS000002NPDES Number: Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: 04-MAY-17Certification Date: Offsite Construction ManagerCertifier Title: Bryan BergeronCertifier: Carbon Canyon CreekReceiving Water Name: NDir Discharge Uswater Ind: NConstype Water Sewer Ind: NConstype Utility Ind: Not reportedConstype Utility Description: NConstype Transport Ind: YConstype Residential Ind: NConstype Recons Ind: NConstype Other Ind: Not reportedConstype Other Description: NConstype Industrial Ind: NConstype Gas Line Ind: NConstype Electrical Line Ind: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 55 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedDischarge City: Not reportedDischarge Name: Not reportedDischarge Address: Not reportedExpiration Date Of Regulatory Measure: Not reportedTermination Date Of Regulatory Measure: Not reportedEffective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: Not reportedProgram Type: ConstructionRegulatory Measure Type: 8 30C379769WDID: Not reportedOrder Number: Not reportedPlace ID: Not reportedRegulatory Measure ID: Not reportedAgency Number: Not reportedRegion: Not reportedNPDES Number: Not reportedFacility Status: Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: Not reportedCertification Date: Not reportedCertifier Title: Not reportedCertifier: Not reportedReceiving Water Name: Not reportedDir Discharge Uswater Ind: Not reportedConstype Water Sewer Ind: Not reportedConstype Utility Ind: Not reportedConstype Utility Description: Not reportedConstype Transport Ind: Not reportedConstype Residential Ind: Not reportedConstype Recons Ind: Not reportedConstype Other Ind: Not reportedConstype Other Description: Not reportedConstype Industrial Ind: Not reportedConstype Gas Line Ind: Not reportedConstype Electrical Line Ind: Not reportedConstype Commertial Ind: Not reportedConstype Comm Line Ind: Not reportedConstype Cable Line Ind: Not reportedConstype Below Ground Ind: Not reportedConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: Not reportedConstype Linear Utility Ind: Not reportedDeveloper Contact Title: Not reportedDeveloper Contact: Not reportedDeveloper Zip: Not reportedDeveloper State: Not reportedDeveloper City: Not reportedDeveloper Address: Not reportedDeveloper: Not reportedOperator Type: Not reportedOperator Contact Email: Not reportedOperator Contact Phone Ext: Not reportedOperator Contact Phone: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 56 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Bryan BergeronDeveloper Contact: 92660Developer Zip: CaliforniaDeveloper State: Newport BeachDeveloper City: 4695 MacArthur CourtDeveloper Address: William Lyon Home IncDeveloper: Private BusinessOperator Type: Bryan.Bergeron@LyonHomes.comOperator Contact Email: Not reportedOperator Contact Phone Ext: 949-476-5441Operator Contact Phone: Offsite Construction ManagerOperator Contact Title: Bryan BergeronOperator Contact: 92660Operator Zip: CaliforniaOperator State: Newport BeachOperator City: 4695 MacArthur CourtOperator Address: William Lyon Home IncOperator Name: Bryan.Bergeron@LyonHomes.comContact Email: Not reportedContact Phone Ext: 949-476-5441Contact Phone: Offsite Construction ManagerContact Title: Bryan BergeronContact: AcresPlace Size Unit: 32.92Place Size: 05/09/2017Status Date: ActiveStatus: 05/09/2017Processed Date: 05/04/2017Received Date: Not reportedDischarge Zip: Not reportedDischarge State: Not reportedDischarge City: Not reportedDischarge Address: Not reportedDischarge Name: Not reportedTermination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: Not reportedEffective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: Not reportedProgram Type: 8 30C379769WDID: Not reportedPlace ID: ConstructionRegulatory Measure Type: Not reportedOrder Number: 485988Regulatory Measure ID: 8Region: Not reportedAgency Number: Not reportedStatus: Not reportedNPDES Number: NPDES as of 03/2018: 92660Operator Zip: CaliforniaOperator State: Newport BeachOperator City: 4695 MacArthur CourtOperator Address: William Lyon Home IncOperator Name: 05/09/2017Status Date: ActiveStatus: Not reportedDischarge Zip: Not reportedDischarge State: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 57 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedContact Phone: Not reportedContact Title: Not reportedContact: Not reportedPlace Size Unit: Not reportedPlace Size: Not reportedStatus Date: Not reportedStatus: Not reportedProcessed Date: Not reportedReceived Date: 92660Discharge Zip: CaliforniaDischarge State: Newport BeachDischarge City: 4695 MacArthur CourtDischarge Address: William Lyon Home IncDischarge Name: Not reportedTermination Date Of Regulatory Measure: Not reportedExpiration Date Of Regulatory Measure: 05/09/2017Effective Date Of Regulatory Measure: Not reportedAdoption Date Of Regulatory Measure: ConstructionProgram Type: 8 30C379769WDID: Not reportedPlace ID: EnrolleeRegulatory Measure Type: 2009-0009-DWQOrder Number: 485988Regulatory Measure ID: 8Region: 0Agency Number: ActiveStatus: CAS000002NPDES Number: Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: 04-MAY-17Certification Date: Offsite Construction ManagerCertifier Title: Bryan BergeronCertifier: Carbon Canyon CreekReceiving Water Name: NDir Discharge Uswater Ind: NConstype Water Sewer Ind: NConstype Utility Ind: Not reportedConstype Utility Description: NConstype Transport Ind: YConstype Residential Ind: NConstype Recons Ind: NConstype Other Ind: Not reportedConstype Other Description: NConstype Industrial Ind: NConstype Gas Line Ind: NConstype Electrical Line Ind: YConstype Commertial Ind: NConstype Comm Line Ind: NConstype Cable Line Ind: NConstype Below Ground Ind: NConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: NConstype Linear Utility Ind: Offsite Construction ManagerDeveloper Contact Title: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 58 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedTertiary Sic: Not reportedSecondary Sic: Not reportedPrimary Sic: Not reportedCertification Date: Not reportedCertifier Title: Not reportedCertifier: Not reportedReceiving Water Name: Not reportedDir Discharge Uswater Ind: Not reportedConstype Water Sewer Ind: Not reportedConstype Utility Ind: Not reportedConstype Utility Description: Not reportedConstype Transport Ind: Not reportedConstype Residential Ind: Not reportedConstype Recons Ind: Not reportedConstype Other Ind: Not reportedConstype Other Description: Not reportedConstype Industrial Ind: Not reportedConstype Gas Line Ind: Not reportedConstype Electrical Line Ind: Not reportedConstype Commertial Ind: Not reportedConstype Comm Line Ind: Not reportedConstype Cable Line Ind: Not reportedConstype Below Ground Ind: Not reportedConstype Above Ground Ind: Not reportedEmergency Phone Ext: Not reportedEmergency Phone: Not reportedConstype Linear Utility Ind: Not reportedDeveloper Contact Title: Not reportedDeveloper Contact: Not reportedDeveloper Zip: Not reportedDeveloper State: Not reportedDeveloper City: Not reportedDeveloper Address: Not reportedDeveloper: Not reportedOperator Type: Not reportedOperator Contact Email: Not reportedOperator Contact Phone Ext: Not reportedOperator Contact Phone: Not reportedOperator Contact Title: Not reportedOperator Contact: Not reportedOperator Zip: Not reportedOperator State: Not reportedOperator City: Not reportedOperator Address: Not reportedOperator Name: Not reportedContact Email: Not reportedContact Phone Ext: CYPRESS GOLF CLUB (Continued)S106387355 TC5646263.2s Page 59 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedSpill Site: Not reportedWaterway: Not reportedWaterway Involved: Not reportedFacility Telephone: Not reportedReport Date: Not reportedReporting Officer Name/ID: Not reportedCompany Name: Not reportedCA DOT PUC/ICC Number: Not reportedVehicle Id Number: Not reportedVehicle State: Not reportedVehicle License Number: Not reportedVehicle Make/year: Not reportedOthers Number Of Fatalities: Not reportedOthers Number Of Injuries: Not reportedOthers Number Of Decontaminated: Not reportedResponding Agency Personel # Of Fatalities: Not reportedResponding Agency Personel # Of Injuries: Not reportedResp Agncy Personel # Of Decontaminated: Not reportedMore Than Two Substances Involved?: Not reportedProperty Management: Not reportedEstimated Temperature: Not reportedSurrounding Area: Not reportedTime Completed: Not reportedTime Notified: Not reportedAgency Incident Number: Not reportedAgency Id Number: Not reportedProperty Use: Not reportedDate Completed: Not reportedOES Time: Not reportedOES Date: 06/09/2006OES notification: 6-3429OES Incident Number: CHMIRS: rePlanet LLCOrganization Name: 151891Organization ID: Mon Closed; Tue - Sat 10:00 am - 4:30 pm, Closed 1:00 pm - 1:30 pm; Sun ClosedHours of Operation: YBimetal: YPlastic: YGlass: YAluminium: 11/01/2014Operation Begin Date: NRural: (877) 737-5263Phone Number: Not reportedEmail: http://www.replanet.comWebsite: 91764Mailing Zip Code: CAMailing State: OntarioMailing City: 800 N Haven Ave Suite 120Mailing Address: RC218172.001Cert Id: 218172Reg Id: SWRCY: 586 ft. Site 1 of 2 in cluster D 0.111 mi. Relative: Higher Actual: 33 ft. < 1/8 CYPRESS, CA 90720 ESE CHMIRS5401 KATELLA AVE N/A D24 SWRCYREPLANET LLC S109039828 TC5646263.2s Page 60 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation signal notifying them of a Freon gas release. Caller advised that an alarm panel is emitting aDescription: Not reportedComments: Not reportedFatals: Not reportedInjuries: Not reportedEvacs: Not reported#3 Vessel >= 300 Tons: Not reported#2 Vessel >= 300 Tons: Not reported#1 Vessel >= 300 Tons: Not reported#3 Pipeline: Not reported#2 Pipeline: Not reported#1 Pipeline: 0Number of Fatalities: 0Number of Injuries: 0Evacuations: Not reportedSubstance #3: Not reportedSubstance #2: 0Unknown: 0.000000Gallons: Freon GasSubstance: Not reportedE Date: Merchant/BusinessSite Type: UnknownContained: Not reportedAmount: Orange County Emergency Managment DivAdmin Agency: 6/9/2006 12:00:00 AMIncident Date: Bills Sound Security / CostcoAgency: 2006Year: Not reportedDate/Time: Not reportedOther: Not reportedMeasure: Not reportedType: Not reportedWhat Happened: Not reportedContainment: UnknownCleanup By: REPLANET LLC (Continued)S109039828 -118.03848Longitude: 33.80311Latitude: Orange County Environmental HealthPermitting Agency: FA0064582Facility ID: UST: 586 ft. Site 2 of 2 in cluster D 0.111 mi. Relative: Higher Actual: 33 ft. < 1/8 CYPRESS, CA 90720 ESE 5401 KATELLA AVE N/A D25 USTCOSTCO WHOLESALE #748 U004263286 TC5646263.2s Page 61 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: 09/15/2001Owner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: Not reportedOwner/operator telephone: USOwner/operator country: Not reported Not reportedOwner/operator address: SANTA FE PROPERTIESOwner/operator name: Not reportedOwner/Op end date: 09/15/2001Owner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: Not reportedOwner/operator telephone: USOwner/operator country: Not reported Not reportedOwner/operator address: DAVID ADAMSOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: PrivateLand type: 09EPA Region: Not reportedContact email: 24Telephone ext.: 562-799-7015Contact telephone: USContact country: LOS ALAMITOS, CA 90720 PO BOX 5367Contact address: DAVID A ADAMSContact: LOS ALAMITOS, CA 90720 PO BOX 5367Mailing address: CAD983586744EPA ID: LOS ALAMITOS, CA 90720 STE B 11082 WINNERS CIRCLEFacility address: ENVIROCON INCFacility name: 10/20/2004Date form received by agency: RCRA NonGen / NLR: 647 ft. Site 3 of 3 in cluster C 0.123 mi. Relative: Lower Actual: 31 ft. < 1/8 ECHOLOS ALAMITOS, CA 90720 SSE FINDS11082 WINNERS CIRCLE CAD983586744 C26 RCRA NonGen / NLRENVIROCON INC 1000594790 TC5646263.2s Page 62 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reported Enf. disp. status date: Not reported Enf. disposition status: 09/10/2002 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/01/2002Date achieved compliance: 09/10/2002Date violation determined: Transporters - GeneralArea of violation: Not reportedRegulation violated: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 09/10/2002 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/01/2002Date achieved compliance: 09/10/2002Date violation determined: Transporters - Manifest and RecordkeepingArea of violation: Not reportedRegulation violated: Not reported Paid penalty amount: 16600 Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 02/11/2003 Enforcement action date: SINGLE SITE CA/FO Enforcement action: StateViolation lead agency: 11/19/2002Date achieved compliance: 09/10/2002Date violation determined: Transporters - Manifest and RecordkeepingArea of violation: Not reportedRegulation violated: Facility Has Received Notices of Violations: Not a generator, verifiedClassification: ENVIROCON INCSite name: 06/27/1991Date form received by agency: Historical Generators: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: YesTransporter of hazardous waste: ENVIROCON INC (Continued)1000594790 TC5646263.2s Page 63 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) and the NCDB (National Compliance Data Base) supports implementation of the Environmental Interest/Information System 110064126565Registry ID: FINDS: StateEvaluation lead agency: 11/01/2002Date achieved compliance: Transporters - Manifest and RecordkeepingArea of violation: COMPLIANCE EVALUATION INSPECTION ON-SITEEvaluation: 09/10/2002Evaluation date: StateEvaluation lead agency: 11/01/2002Date achieved compliance: Transporters - GeneralArea of violation: COMPLIANCE EVALUATION INSPECTION ON-SITEEvaluation: 09/10/2002Evaluation date: StateEvaluation lead agency: Not reportedDate achieved compliance: Not reportedArea of violation: SIGNIFICANT NON-COMPLIEREvaluation: 09/10/2002Evaluation date: StateEvaluation lead agency: 11/19/2002Date achieved compliance: Transporters - Manifest and RecordkeepingArea of violation: COMPLIANCE EVALUATION INSPECTION ON-SITEEvaluation: 09/10/2002Evaluation date: StateEvaluation lead agency: Not reportedDate achieved compliance: Not reportedArea of violation: NOT A SIGNIFICANT NON-COMPLIEREvaluation: 11/19/2002Evaluation date: Evaluation Action Summary: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 09/10/2002 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/19/2002Date achieved compliance: 09/10/2002Date violation determined: Transporters - Manifest and RecordkeepingArea of violation: Not reportedRegulation violated: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: ENVIROCON INC (Continued)1000594790 TC5646263.2s Page 64 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation http://echo.epa.gov/detailed-facility-report?fid=110064126565DFR URL: 110064126565Registry ID: 1000594790Envid: ECHO: additional FINDS: detail in the EDR Site Report. Click this hyperlink while viewing on your computer to access corrective action activities required under RCRA. program staff to track the notification, permit, compliance, and and treat, store, or dispose of hazardous waste. RCRAInfo allows RCRA events and activities related to facilities that generate, transport, Conservation and Recovery Act (RCRA) program through the tracking of RCRAInfo is a national information system that supports the Resource and settlements. regions and states with cooperative agreements, enforcement actions, Toxic Substances Control Act (TSCA). The system tracks inspections in ENVIROCON INC (Continued)1000594790 GEORGE TOWNSHENDOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-225-3590Owner/operator telephone: Not reportedOwner/operator country: LOS ALAMITOS, CA 90720 11132 MINDORA STREETOwner/operator address: GEORGE TOWNSHENDOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: GTOWNSHEND@GMAIL.COMContact email: 562-225-3590Contact telephone: Not reportedContact country: LOS ALAMITOS, CA 90720 11132 MINDORA STREETContact address: GEORGE TOWNSHENDContact: CAC002982790EPA ID: LOS ALAMITOS, CA 90720 11132 MINDORA STREETFacility address: GEORGE TOWNSHEND SFRFacility name: 10/01/2018Date form received by agency: RCRA NonGen / NLR: 766 ft. 0.145 mi. Relative: Lower Actual: 31 ft. 1/8-1/4 LOS ALAMITOS, CA 90720 South 11132 MINDORA STREET CAC002982790 27 RCRA NonGen / NLRGEORGE TOWNSHEND SFR 1024762928 TC5646263.2s Page 65 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-225-3590Owner/operator telephone: Not reportedOwner/operator country: LOS ALAMITOS, CA 90720 11132 MINDORA STREETOwner/operator address: GEORGE TOWNSHEND SFR (Continued) 1024762928 FA0045719Facility ID: ORANGE CO. UST: -118.03713Longitude: 33.80443Latitude: Orange County Environmental HealthPermitting Agency: FA0045719Facility ID: UST: 896 ft. Site 1 of 2 in cluster E 0.170 mi. Relative: Higher Actual: 36 ft. 1/8-1/4 CYPRESS, CA 90630 ENE 10901 WALKER ST N/A E28 USTCOSTCO WHOLESALE #748 (GAS STATION) U004004601 5401 KATELLA AVEFacility address: COSTCO WHOLESALE NO 748Facility name: 03/01/2018Date form received by agency: RCRA-LQG: 896 ft. Site 2 of 2 in cluster E 0.170 mi. Relative: Higher Actual: 36 ft. 1/8-1/4 CYPRESS, CA 90630 ENE HAZNET5401 KATELLA AVE CAR000160200 E29 RCRA-LQGCOSTCO WHOLESALE NO 748 1007989088 TC5646263.2s Page 66 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation USOwner/operator country: Not reported Not reportedOwner/operator address: COSTCO WHOLESALE CORPOwner/operator name: Not reportedOwner/Op end date: 09/03/2004Owner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: RTHOMPSON@COSTCO.COMOwner/operator email: 425-313-8100Owner/operator telephone: USOwner/operator country: ISSAQUAH, WA 98027 LAKE DROwner/operator address: COSTCO WHOLESALE CORPORATIONOwner/operator name: Not reportedOwner/Op end date: 07/14/2005Owner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: RTHOMPSON@COSTCO.COMOwner/operator email: 425-313-8100Owner/operator telephone: USOwner/operator country: ISSAQUAH, WA 98027 LAKE DROwner/operator address: COSTCO WHOLESALE CORPORATIONOwner/operator name: Owner/Operator Summary: 100 kg of that material at any time hazardous waste during any calendar month, and accumulates more than from the cleanup of a spill, into or on any land or water, of acutely of any residue or contaminated soil, waste or other debris resulting kg of acutely hazardous waste at any time; or generates 100 kg or less hazardous waste during any calendar month, and accumulates more than 1 waste during any calendar month; or generates 1 kg or less of acutely cleanup of a spill, into or on any land or water, of acutely hazardous residue or contaminated soil, waste or other debris resulting from the during any calendar month; or generates more than 100 kg of any calendar month; or generates more than 1 kg of acutely hazardous waste Handler: generates 1,000 kg or more of hazardous waste during anyDescription: Large Quantity GeneratorClassification: 09EPA Region: RTHOMPSON@COSTCO.COMContact email: 425-313-6674Contact telephone: USContact country: ISSAQUAH, WA 98027 LAKE DRContact address: ROSE THOMPSONContact: CARLSBAD, CA 92010 CA90720 CA059US 3207 GREY HAWK CT, SUITE 200Mailing address: CAR000160200EPA ID: CYPRESS, CA 90630-0000 COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 67 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation (E)- DIETHYLSTILBESTEROL (OR) PHENOL, 4,4’-(1,2-DIETHYL-1,2-ETHENEDIYL)BIS,. Waste name: U089. Waste code: L-PHENYLALANINE, 4-[BIS(2-CHLOROETHYL)AMINO]- (OR) MELPHALAN. Waste name: U150. Waste code: (3BETA, 16BETA, 17ALPHA, 18BETA, 20ALPHA)- 11,17-DIMETHOXY-18-[(3,4,5-TRIMETHOXYBENZOYL)OXY]-, METHYL ESTER, RESERPINE (OR) YOHIMBAN-16-CARBOXYLIC ACID,. Waste name: U200. Waste code: CARBARYL (OR) 1-NAPHTHALENOL, METHYLCARBAMATE. Waste name: U279. Waste code: Alkaline solution without metals (pH > 12.5). Waste name: 122. Waste code: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: 09/03/2004Owner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 425-313-8100Owner/operator telephone: USOwner/operator country: ISSAQUAH, WA 98027 999 LAKE DROwner/operator address: COSTCO WHOLESALE CORPOwner/operator name: Not reportedOwner/Op end date: 07/14/2005Owner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: Not reportedOwner/operator telephone: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 68 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation CORROSIVE WASTE. Waste name: D002. Waste code: IGNITABLE WASTE. Waste name: D001. Waste code: Liquids with pH < 2. Waste name: 791. Waste code: Off-specification, aged, or surplus organics. Waste name: 331. Waste code: Pharmaceutical waste. Waste name: 311. Waste code: Unspecified solvent mixture. Waste name: 214. Waste code: Other inorganic solid waste. Waste name: 181. Waste code: Off-specification, aged, or surplus inorganics. Waste name: 141. Waste code: MITOMYCIN C HOXY-5-METHYL-, [1AS-(1AALPHA, 8BETA, 8AALPHA, 8BALPHA)]- (OR) 6-AMINO-8-[[(AMINOCARBONYL)OXY]METHYL]-1,1A,2,8,8A,8B-HEXAHYDRO-8A-MET AZIRINO [2’,3’:3,4]PYRROLO[1,2-A]INDOLE-4,7-DIONE,. Waste name: U010. Waste code: AZASERINE (OR) L-SERINE, DIAZOACETATE (ESTER). Waste name: U015. Waste code: ACETALDEHYDE, TRICHLORO- (OR) CHLORAL. Waste name: U034. Waste code: BENZENEBUTANOIC ACID, 4-[BIS(2-CHLOROETHYL)AMINO]- (OR) CHLORAMBUCIL. Waste name: U035. Waste code: CHLOROFORM (OR) METHANE, TRICHLORO-. Waste name: U044. Waste code: CYCLOHEXANONE (I). Waste name: U057. Waste code: 2-OXIDE (OR) CYCLOPHOSPHAMIDE 2H-1,3,2-OXAZAPHOSPHORIN-2-AMINE, N,N-BIS(2-CHLOROETHYL)TETRAHYDRO-,. Waste name: U058. Waste code: DAUNOMYCIN 7,8,9,10-TETRAHYDRO-6,8,11-TRIHYDROXY-1-METHOXY-, (8S-CIS)- (OR) 8-ACETYL-10-[(3-AMINO-2,3,6-TRIDEOXY)-ALPHA-L-LYXO-HEXOPYRANOSYL)OXY]- 5,12-NAPHTHACENEDIONE,. Waste name: U059. Waste code: DICHLORODIFLUOROMETHANE (OR) METHANE, DICHLORODIFLUORO-. Waste name: U075. Waste code: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 69 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 131. Waste code: Alkaline solution without metals (pH > 12.5). Waste name: 122. Waste code: Large Quantity GeneratorClassification: COSTCO WHOLESALE # 748Site name: 08/08/2016Date form received by agency: Historical Generators: SALTS NICOTINE, & SALTS (OR) PYRIDINE, 3-(1-METHYL-2-PYRROLIDINYL)-,(S)-, &. Waste name: P075. Waste code: SALTS, WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% (OR) WARFARIN, & 2H-1-BENZOPYRAN-2-ONE, 4-HYDROXY-3-(3-OXO-1-PHENYLBUTYL)-, & SALTS,. Waste name: P001. Waste code: METHYL ETHYL KETONE. Waste name: D035. Waste code: CRESOL. Waste name: D026. Waste code: M-CRESOL. Waste name: D024. Waste code: CHLOROFORM. Waste name: D022. Waste code: 2,4-D (2,4-DICHLOROPHENOXYACETIC ACID). Waste name: D016. Waste code: LINDANE (1,2,3,4,5,6-HEXA-CHLOROCYCLOHEXANE, GAMMA ISOMER). Waste name: D013. Waste code: SILVER. Waste name: D011. Waste code: SELENIUM. Waste name: D010. Waste code: MERCURY. Waste name: D009. Waste code: LEAD. Waste name: D008. Waste code: CHROMIUM. Waste name: D007. Waste code: BARIUM. Waste name: D005. Waste code: ARSENIC. Waste name: D004. Waste code: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 70 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 122. Waste code: Large Quantity GeneratorClassification: COSTCO WHOLESALE NO 748Site name: 05/05/2014Date form received by agency: SALTS NICOTINE, & SALTS (OR) PYRIDINE, 3-(1-METHYL-2-PYRROLIDINYL)-,(S)-, &. Waste name: P075. Waste code: SALTS, WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% (OR) WARFARIN, & 2H-1-BENZOPYRAN-2-ONE, 4-HYDROXY-3-(3-OXO-1-PHENYLBUTYL)-, & SALTS,. Waste name: P001. Waste code: BENZENE. Waste name: D018. Waste code: 2,4-D (2,4-DICHLOROPHENOXYACETIC ACID). Waste name: D016. Waste code: SILVER. Waste name: D011. Waste code: SELENIUM. Waste name: D010. Waste code: MERCURY. Waste name: D009. Waste code: CORROSIVE WASTE. Waste name: D002. Waste code: IGNITABLE WASTE. Waste name: D001. Waste code: Other organic solids. Waste name: 352. Waste code: Off-specification, aged, or surplus organics. Waste name: 331. Waste code: Pharmaceutical waste. Waste name: 311. Waste code: Unspecified solvent mixture. Waste name: 214. Waste code: Other inorganic solid waste. Waste name: 181. Waste code: Off-specification, aged, or surplus inorganics. Waste name: 141. Waste code: perchlorate, and sulfide anions) bromate, chlorate, cyanide, fluoride, hypochlorite, nitrite, Aqueous solution (2 < pH < 12.5) containing reactive anions (azide,. Waste name: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 71 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation D003. Waste code: CADMIUM. Waste name: D006. Waste code: CHROMIUM. Waste name: D007. Waste code: LEAD. Waste name: D008. Waste code: MERCURY. Waste name: D009. Waste code: SELENIUM. Waste name: D010. Waste code: SILVER. Waste name: D011. Waste code: BENZENE. Waste name: D018. Waste code: M-CRESOL. Waste name: D024. Waste code: CRESOL. Waste name: D026. Waste code: METHYL ETHYL KETONE. Waste name: D035. Waste code: MIXTURES. BOTTOMS FROM THE RECOVERY OF THESE SPENT SOLVENTS AND SPENT SOLVENT MORE OF THOSE SOLVENTS LISTED IN F001, F002, F004, AND F005; AND STILL SOLVENTS, AND A TOTAL OF TEN PERCENT OR MORE (BY VOLUME) OF ONE OR CONTAINING, BEFORE USE, ONE OR MORE OF THE ABOVE NONHALOGENATED NONHALOGENATED SOLVENTS; AND ALL SPENT SOLVENT MIXTURES/BLENDS MIXTURES/BLENDS CONTAINING, BEFORE USE, ONLY THE ABOVE SPENT ALCOHOL, CYCLOHEXANONE, AND METHANOL; ALL SPENT SOLVENT ACETATE, ETHYL BENZENE, ETHYL ETHER, METHYL ISOBUTYL KETONE, N-BUTYL THE FOLLOWING SPENT NONHALOGENATED SOLVENTS: XYLENE, ACETONE, ETHYL. Waste name: F003. Waste code: SALTS, WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% (OR) WARFARIN, & 2H-1-BENZOPYRAN-2-ONE, 4-HYDROXY-3-(3-OXO-1-PHENYLBUTYL)-, & SALTS,. Waste name: P001. Waste code: SALTS NICOTINE, & SALTS (OR) PYRIDINE, 3-(1-METHYL-2-PYRROLIDINYL)-,(S)-, &. Waste name: P075. Waste code: ACETALDEHYDE, TRICHLORO- (OR) CHLORAL. Waste name: U034. Waste code: Alkaline solution without metals (pH > 12.5). Waste name: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 72 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 213. Waste code: Unspecified solvent mixture. Waste name: 214. Waste code: Waste oil and mixed oil. Waste name: 221. Waste code: Unspecified oil-containing waste. Waste name: 223. Waste code: Pesticides and other waste associated with pesticide production. Waste name: 232. Waste code: Organic monomer waste (includes unreacted resins). Waste name: 271. Waste code: Polymeric resin waste. Waste name: 272. Waste code: Adhesives. Waste name: 281. Waste code: Latex waste. Waste name: 291. Waste code: Pharmaceutical waste. Waste name: 311. Waste code: Off-specification, aged, or surplus organics. Waste name: 331. Waste code: Unspecified organic liquid mixture. Waste name: 343. Waste code: Other organic solids. Waste name: 352. Waste code: Photochemicals / photo processing waste. Waste name: 541. Waste code: Detergent and soap. Waste name: 561. Waste code: Contaminated soil from site clean-ups. Waste name: 611. Waste code: Liquids with pH < 2. Waste name: 791. Waste code: IGNITABLE WASTE. Waste name: D001. Waste code: CORROSIVE WASTE. Waste name: D002. Waste code: REACTIVE WASTE. Waste name: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 73 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation FLASH POINT OF A WASTE IS TO REVIEW THE MATERIAL SAFETY DATA SHEET, CLOSED CUP FLASH POINT TESTER. ANOTHER METHOD OF DETERMINING THE LESS THAN 140 DEGREES FAHRENHEIT AS DETERMINED BY A PENSKY-MARTENS IGNITABLE HAZARDOUS WASTES ARE THOSE WASTES WHICH HAVE A FLASHPOINT OFWaste name: D001Waste code: Annual Waste Handled: Last Biennial Reporting Year: 2017 Biennial Reports: SILVER. Waste name: D011. Waste code: BENZENE. Waste name: D018. Waste code: IGNITABLE WASTE. Waste name: D001. Waste code: Small Quantity GeneratorClassification: COSTCO WHOLESALE NO 748Site name: 02/04/2005Date form received by agency: perchlorate, and sulfide anions) bromate, chlorate, cyanide, fluoride, hypochlorite, nitrite, Aqueous solution (2 < pH < 12.5) containing reactive anions (azide,. Waste name: 131. Waste code: Aqueous solution with 10% or more total organic residues. Waste name: 133. Waste code: Aqueous solution with <10% total organic residues. Waste name: 134. Waste code: Unspecified aqueous solution. Waste name: 135. Waste code: Off-specification, aged, or surplus inorganics. Waste name: 141. Waste code: Asbestos-containing waste. Waste name: 151. Waste code: Metal dust (see 121) and machining waste. Waste name: 172. Waste code: Other inorganic solid waste. Waste name: 181. Waste code: etc.) Halogenated solvents (chloroform, methyl chloride, perchloroethylene,. Waste name: 211. Waste code: Oxygenated solvents (acetone, butanol, ethyl acetate, etc.). Waste name: 212. Waste code: Hydrocarbon solvents (benzene, hexane, Stoddard, etc.). Waste name: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 74 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation NVT330010000TSD EPA ID: OrangeGen County: CARLSBAD, CA 92010Mailing City,St,Zip: 3207 GREY HAWK CT STE 200Mailing Address: Not reportedMailing Name: 4253136275Telephone: LISA SIMPSONContact: CAR000160200GEPAID: 2017Year: COSTCO WHOLESALE NO 748Site Name: HAZNET: No violations foundViolation Status: 19Amount (Lbs): NICOTINE, & SALTSWaste name: P075Waste code: 10Amount (Lbs): WHEN PRESENT AT CONCENTRATIONS GREATER THAN 0.3% 2H-1-BENZOPYRAN-2-ONE, 4-HYDROXY-3-(3-OXO-1-PHENYLBUTYL)-, & SALTS,Waste name: P001Waste code: 892Amount (Lbs): BENZENEWaste name: D018Waste code: 42Amount (Lbs): 2,4-DWaste name: D016Waste code: 71Amount (Lbs): SILVERWaste name: D011Waste code: 71Amount (Lbs): SELENIUMWaste name: D010Waste code: 20Amount (Lbs): MERCURYWaste name: D009Waste code: 449Amount (Lbs): DISPOSED, THE WASTE WOULD BE A CORROSIVE HAZARDOUS WASTE. THESE CAUSTIC OR ACID SOLUTIONS BECOME CONTAMINATED AND MUST BE USED BY MANY INDUSTRIES TO CLEAN METAL PARTS PRIOR TO PAINTING. WHEN OR DEGREASE PARTS. HYDROCHLORIC ACID, A SOLUTION WITH A LOW PH, IS CAUSTIC SOLUTION WITH A HIGH PH, IS OFTEN USED BY INDUSTRIES TO CLEAN CONSIDERED TO BE A CORROSIVE HAZARDOUS WASTE. SODIUM HYDROXIDE, A A WASTE WHICH HAS A PH OF LESS THAN 2 OR GREATER THAN 12.5 ISWaste name: D002Waste code: 1909Amount (Lbs): WHICH WOULD BE CONSIDERED AS IGNITABLE HAZARDOUS WASTE. MATERIAL. LACQUER THINNER IS AN EXAMPLE OF A COMMONLY USED SOLVENT WHICH CAN BE OBTAINED FROM THE MANUFACTURER OR DISTRIBUTOR OF THE COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 75 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 3207 GREY HAWK CT STE 200Mailing Address: Not reportedMailing Name: 4253136275Telephone: LISA SIMPSONContact: CAR000160200GEPAID: 2017Year: COSTCO WHOLESALE NO 748Site Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Off-specification, aged or surplus organicsCat Decode: 0.5595Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Off-specification, aged or surplus organicsWaste Category: Los AngelesTSD County: CAD008364432TSD EPA ID: OrangeGen County: CARLSBAD, CA 92010Mailing City,St,Zip: 3207 GREY HAWK CT STE 200Mailing Address: Not reportedMailing Name: 4253136275Telephone: LISA SIMPSONContact: CAR000160200GEPAID: 2017Year: COSTCO WHOLESALE NO 748Site Name: OrangeFacility County: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Method Decode: Aqueous solution with total organic residues less than 10 percentCat Decode: 0.147Tons: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Disposal Method: Aqueous solution with total organic residues less than 10 percentWaste Category: Los AngelesTSD County: CAT080013352TSD EPA ID: OrangeGen County: CARLSBAD, CA 92010Mailing City,St,Zip: 3207 GREY HAWK CT STE 200Mailing Address: Not reportedMailing Name: 4253136275Telephone: LISA SIMPSONContact: CAR000160200GEPAID: 2017Year: COSTCO WHOLESALE NO 748Site Name: OrangeFacility County: Include On-Site Treatment And/Or Stabilization) Landfill Or Surface Impoundment That Will Be Closed As Landfill( ToMethod Decode: Other organic solidsCat Decode: 0.1175Tons: Include On-Site Treatment And/Or Stabilization) Landfill Or Surface Impoundment That Will Be Closed As Landfill( ToDisposal Method: Other organic solidsWaste Category: 99TSD County: COSTCO WHOLESALE NO 748 (Continued) 1007989088 TC5646263.2s Page 76 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 94 additional CA_HAZNET: record(s) in the EDR Site Report. Click this hyperlink while viewing on your computer to access OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Unspecified solvent mixtureCat Decode: 0.0535Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Unspecified solvent mixtureWaste Category: Los AngelesTSD County: CAD008364432TSD EPA ID: OrangeGen County: CARLSBAD, CA 92010Mailing City,St,Zip: 3207 GREY HAWK CT STE 200Mailing Address: Not reportedMailing Name: 4253136275Telephone: LISA SIMPSONContact: CAR000160200GEPAID: 2017Year: COSTCO WHOLESALE NO 748Site Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Pharmaceutical wasteCat Decode: 0.004Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Pharmaceutical wasteWaste Category: Los AngelesTSD County: CAD008364432TSD EPA ID: OrangeGen County: CARLSBAD, CA 92010Mailing City,St,Zip: COSTCO WHOLESALE NO 748 (Continued) 1007989088 Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: MILES@COOLANTMANAGEMENT.COMContact email: 562-795-0470Contact telephone: Not reportedContact country: LOS ALAMITOS, CA 90720 11052 VIA EL MERCADOContact address: MILES ARNOLDContact: CAL000229936EPA ID: LOS ALAMITOS, CA 90720-0000 11052 VIA EL MERCADOFacility address: COOLANT MANAGEMENT SERVICES CO INCFacility name: 11/01/2001Date form received by agency: RCRA NonGen / NLR: 913 ft. Site 1 of 3 in cluster F 0.173 mi. Relative: Higher Actual: 33 ft. 1/8-1/4 LOS ALAMITOS, CA 90720 SE 11052 VIA EL MERCADO CAL000229936 F30 RCRA NonGen / NLRCOOLANT MANAGEMENT SERVICES CO INC 1024801384 TC5646263.2s Page 77 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: YesTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-795-0470Owner/operator telephone: Not reportedOwner/operator country: LOS ALAMITOS, CA 90720 11052 VIA EL MERCADOOwner/operator address: MILES ARNOLDOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-795-0470Owner/operator telephone: Not reportedOwner/operator country: LOS ALAMITOS, CA 90720 11052 VIA EL MERCADOOwner/operator address: MILES ARNOLDOwner/operator name: Owner/Operator Summary: COOLANT MANAGEMENT SERVICES CO INC (Continued) 1024801384 Not reportedFacility ID: 10448128CERSID: Not reportedTotal Gallons: Same as aboveOwner: Not reportedCertified Unified Program Agencies: AST: 913 ft. Site 2 of 3 in cluster F 0.173 mi. Relative: Higher Actual: 33 ft. 1/8-1/4 LOS ALAMITOS, CA 90720 SE 11052 VIA EL MERCADO N/A F31 ASTCOOLANT MANAGEMENT SERVICES A100418996 TC5646263.2s Page 78 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation calooo229936EPAID: United StatesProperty Owner Country: Not reportedProperty Owner Zip Code: Not reportedProperty Owner Stat : Not reportedProperty Owner City: Not reportedProperty Owner Mailing Address: Not reportedProperty Owner Phone: Same as aboveProperty Owner Name: United StatesOwner Country: Not reportedOwner Zip Code: Not reportedOwner State: Not reportedOwner Mail Address: Not reportedOwner Phone: 714-323-5103Operator Phone: Miles ArnoldOperator Name: 90720Mailing Address Zip Code: CaMailing Address State: Los AlamitosMailing Address City: 11052 Via El MercadoMailing Address: 562-795-0475Fax: 562-795-0470Phone: Coolant Management ServicesBusiness Name: COOLANT MANAGEMENT SERVICES (Continued) A100418996 Not reportedEPAID: Not reportedProperty Owner Country: Not reportedProperty Owner Zip Code: Not reportedProperty Owner Stat : Not reportedProperty Owner City: Not reportedProperty Owner Mailing Address: Not reportedProperty Owner Phone: Not reportedProperty Owner Name: Not reportedOwner Country: Not reportedOwner Zip Code: Not reportedOwner State: Not reportedOwner Mail Address: Not reportedOwner Phone: Not reportedOperator Phone: Not reportedOperator Name: Not reportedMailing Address Zip Code: Not reportedMailing Address State: Not reportedMailing Address City: Not reportedMailing Address: Not reportedFax: Not reportedPhone: Not reportedBusiness Name: Not reportedFacility ID: Not reportedCERSID: 1,320Total Gallons: COOLANT MANAGEMENT SERVICESOwner: OrangeCertified Unified Program Agencies: AST: 913 ft. Site 3 of 3 in cluster F 0.173 mi. Relative: Higher Actual: 33 ft. 1/8-1/4 LOS ALAMITOS, CA SE 11052 VIA EL MERCADO N/A F32 AST A100336674 TC5646263.2s Page 79 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: YesTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OwnerOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-795-1701Owner/operator telephone: Not reportedOwner/operator country: CYPRESS, CA 90630 10900 WALKER STOwner/operator address: LTP MODERN MACHINE INCOwner/operator name: Not reportedOwner/Op end date: Not reportedOwner/Op start date: OperatorOwner/Operator Type: OtherLegal status: Not reportedOwner/operator extension: Not reportedOwner/operator fax: Not reportedOwner/operator email: 562-795-1701Owner/operator telephone: Not reportedOwner/operator country: CYPRESS, CA 90630 10900 WALKER STOwner/operator address: THANH PHANOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: 09EPA Region: ALEX.GOMEZ@LTPMODERNMACHINE.COMContact email: 562-795-1701Contact telephone: Not reportedContact country: CYPRESS, CA 90630 10900 WALKER STContact address: THANH PHANContact: CAL000420984EPA ID: CYPRESS, CA 90630 10900 WALKER STFacility address: LTP MODERN MACHINE INCFacility name: 10/11/2016Date form received by agency: RCRA NonGen / NLR: 1183 ft. 0.224 mi. Relative: Higher Actual: 36 ft. 1/8-1/4 CYPRESS, CA 90630 ENE 10900 WALKER ST CAL000420984 33 RCRA NonGen / NLRLTP MODERN MACHINE INC 1024856727 TC5646263.2s Page 80 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation No violations foundViolation Status: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: LTP MODERN MACHINE INC (Continued) 1024856727 Leak ReportedAction: 08/27/1991Date: OtherAction Type: T0605901416Global Id: LUST: 7144336251Phone Number: tescobedo@ochca.comEmail: SANTA ANACity: 1241 EAST DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: TAMARA ESCOBEDOContact Name: Local Agency CaseworkerContact Type: T0605901416Global Id: Not reportedPhone Number: nolson-martin@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: NANCY OLSON-MARTINContact Name: Regional Board CaseworkerContact Type: T0605901416Global Id: LUST: Not reportedSite History: GasolinePotential Contaminants of Concern: Other Groundwater (uses other than drinking water)Potential Media Affect: 91UT095Local Case Number: Local AgencyFile Location: ORANGE COUNTY LOPLocal Agency: 083001897TRB Case Number: TECase Worker: 06/11/2002Status Date: Completed - Case ClosedStatus: -118.0457035Longitude: 33.8104567Latitude: T0605901416Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605901416Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: LUST: 2073 ft. Site 1 of 2 in cluster G 0.393 mi. Relative: Higher Actual: 32 ft. 1/4-1/2 CYPRESS, CA 90630 NNW 5001 CERRITOS N/A G34 LUSTROBERT KAHN PROPERTY/FORMER HRAKO SRVC CNTR S106447590 TC5646263.2s Page 81 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedDate Remediation Plan Submitted: Not reportedDate Pollution Characterization Began: Not reportedDate Prelim Assessment Workplan Submitted: 6/11/2002Close Date: Not reportedEnforcement Date: 8/27/1991Discover Date: Not reportedDate Preliminary Assessment Began: Not reportedDate Confirmation of Leak Began: Not reportedEnter Date: 9/9/9999How Stopped Date: T0605901416Global ID: UnknownLeak Source: UnknownLeak Cause: Close TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: Not reportedEnf Type: Not reportedCross Street: Not reportedAbate Method: 0Qty Leaked: GasolineSubstance: Other ground water affectedCase Type: 91UT095Local Case Num: 083001897TCase Number: Case ClosedFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: RO0000841Record ID: 06/11/2002Date Closed: Gasoline-Automotive (motor gasoline and additives), leaded & unleadedReleased Substance: 91UT095Facility Id: ORANGERegion: ORANGE CO. LUST: 08/27/1991Status Date: Open - Case Begin DateStatus: T0605901416Global Id: 06/11/2002Status Date: Completed - Case ClosedStatus: T0605901416Global Id: LUST: Leak DiscoveryAction: 08/27/1991Date: OtherAction Type: T0605901416Global Id: ExcavationAction: 01/26/1998Date: REMEDIATIONAction Type: T0605901416Global Id: ROBERT KAHN PROPERTY/FORMER HRAKO SRVC CNTR (Continued) S106447590 TC5646263.2s Page 82 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: ARStaff Initials: NOMStaff: *MTBE Class: MTBE Detected. Site tested for MTBE & MTBE detectedMTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 0MTBE Concentration: 2.3Max MTBE GW: 12/11/2001MTBE Date: -118.0457035Longitude: 33.8104567Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: =GW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: Not reportedDate Remedial Action Underway: ROBERT KAHN PROPERTY/FORMER HRAKO SRVC CNTR (Continued) S106447590 09-30-92Referral Date: 44-016705Board Of Equalization: 9Number: 8661Comp Number: ActiveStatus: 4Number Of Tanks: Not reportedContent: PSTG: PETROLEUMTank Use: Not reportedActive Date: 500Capacity: ATank Status: 30-000-008661-000001SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-016705Board Of Equalization: 9Number: 8661Comp Number: ActiveStatus: SWEEPS UST: 2073 ft. Site 2 of 2 in cluster G 0.393 mi. Relative: Higher Actual: 32 ft. 1/4-1/2 HIST CORTESECYPRESS, CA 90630 NNW CA FID UST5001 BALL RD N/A G35 SWEEPS USTUNOCAL #5330 S101589119 TC5646263.2s Page 83 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 500Capacity: ATank Status: 30-000-013666-000001SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 13666Comp Number: ActiveStatus: Not reportedNumber Of Tanks: DIESELContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 7000Capacity: ATank Status: 30-000-008661-000005SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-016705Board Of Equalization: 9Number: 8661Comp Number: ActiveStatus: Not reportedNumber Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 7000Capacity: ATank Status: 30-000-008661-000004SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-016705Board Of Equalization: 9Number: 8661Comp Number: ActiveStatus: Not reportedNumber Of Tanks: LEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 3000Capacity: ATank Status: 30-000-008661-000003SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: UNOCAL #5330 (Continued)S101589119 TC5646263.2s Page 84 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedNumber Of Tanks: DIESELContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 7000Capacity: ATank Status: 30-000-013666-000004SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 13666Comp Number: ActiveStatus: Not reportedNumber Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 7000Capacity: ATank Status: 30-000-013666-000003SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 13666Comp Number: ActiveStatus: Not reportedNumber Of Tanks: LEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 3000Capacity: ATank Status: 30-000-013666-000002SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: Not reportedBoard Of Equalization: 9Number: 13666Comp Number: ActiveStatus: 4Number Of Tanks: Not reportedContent: PSTG: PETROLEUMTank Use: Not reportedActive Date: UNOCAL #5330 (Continued)S101589119 TC5646263.2s Page 85 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 083001897TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: 083002183TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: HIST CORTESE: ActiveStatus: Not reportedComments: Not reportedEPA ID: Not reportedNPDES Number: Not reportedDUNs Number: Not reportedContact Phone: Not reportedContact: CYPRESS 90630Mailing City,St,Zip: Not reportedMailing Address 2: 911 WILSHIRE BLVD STE 10Mailing Address: Not reportedMail To: 7148261510Facility Phone: Not reportedSIC Code: Not reportedCortese Code: Not reportedRegulated ID: UTNKARegulated By: 30001353Facility ID: CA FID UST: UNOCAL #5330 (Continued)S101589119 Regional Board CaseworkerContact Type: T0605902092Global Id: LUST: Not reportedSite History: Diesel, GasolinePotential Contaminants of Concern: Other Groundwater (uses other than drinking water)Potential Media Affect: 97UT031Local Case Number: Local Agency WarehouseFile Location: ORANGE COUNTY LOPLocal Agency: 083003072TRB Case Number: TECase Worker: 07/21/2004Status Date: Completed - Case ClosedStatus: -118.0458325Longitude: 33.8104537Latitude: T0605902092Global Id: http://geotracker.waterboards.ca.gov/profile_report.asp?global_id=T0605902092Geo Track: LUST Cleanup SiteCase Type: ORANGE COUNTY LOPLead Agency: LUST: 2182 ft. 0.413 mi.HIST CORTESE Relative: Higher Actual: 32 ft. 1/4-1/2 CA FID USTCYPRESS, CA 90630 NNW SWEEPS UST4991 CERRITOS N/A 36 LUSTORANGE COUNTY FIRE STATION #17 U002096241 TC5646263.2s Page 86 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Staff LetterAction: 04/14/2004Date: ENFORCEMENTAction Type: T0605902092Global Id: Staff LetterAction: 10/06/2003Date: ENFORCEMENTAction Type: T0605902092Global Id: Staff LetterAction: 07/16/2003Date: ENFORCEMENTAction Type: T0605902092Global Id: Notice of ResponsibilityAction: 09/12/1997Date: ENFORCEMENTAction Type: T0605902092Global Id: Closure/No Further Action LetterAction: 12/20/2004Date: ENFORCEMENTAction Type: T0605902092Global Id: Leak DiscoveryAction: 07/30/1997Date: OtherAction Type: T0605902092Global Id: In Situ Physical/Chemical Treatment (other than SVE)Action: 01/08/2004Date: REMEDIATIONAction Type: T0605902092Global Id: Leak ReportedAction: 09/09/1997Date: OtherAction Type: T0605902092Global Id: LUST: 7144336251Phone Number: tescobedo@ochca.comEmail: SANTA ANACity: 1241 EAST DYER ROAD SUITE 120Address: ORANGE COUNTY LOPOrganization Name: TAMARA ESCOBEDOContact Name: Local Agency CaseworkerContact Type: T0605902092Global Id: Not reportedPhone Number: nolson-martin@waterboards.ca.govEmail: RIVERSIDECity: 3737 MAIN STREET, SUITE 500Address: SANTA ANA RWQCB (REGION 8)Organization Name: NANCY OLSON-MARTINContact Name: ORANGE COUNTY FIRE STATION #17 (Continued) U002096241 TC5646263.2s Page 87 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 2/24/2003Date Remediation Plan Submitted: Not reportedDate Pollution Characterization Began: Not reportedDate Prelim Assessment Workplan Submitted: 12/20/2004Close Date: Not reportedEnforcement Date: 7/30/1997Discover Date: Not reportedDate Preliminary Assessment Began: Not reportedDate Confirmation of Leak Began: Not reportedEnter Date: 4/1/1998How Stopped Date: T0605902092Global ID: DLeak Source: UnknownLeak Cause: Close TankHow Stopped: SAHow Discovered: Not reportedFunding: CLOSEnf Type: Not reportedCross Street: Not reportedAbate Method: 0Qty Leaked: 12034,800661Substance: Other ground water affectedCase Type: 97UT031Local Case Num: 083003072TCase Number: Case ClosedFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: RO0001780Record ID: 12/20/2004Date Closed: (motor gasoline and additives), leaded & unleaded Diesel fuel oil and additives, Nos.1-D, 2-D, 2-4; Gasoline-AutomotiveReleased Substance: 97UT031Facility Id: ORANGERegion: ORANGE CO. LUST: 02/24/2003Status Date: Open - RemediationStatus: T0605902092Global Id: 07/30/1997Status Date: Open - Case Begin DateStatus: T0605902092Global Id: 07/21/2004Status Date: Completed - Case ClosedStatus: T0605902092Global Id: LUST: Leak StoppedAction: 04/01/1998Date: OtherAction Type: T0605902092Global Id: ORANGE COUNTY FIRE STATION #17 (Continued) U002096241 TC5646263.2s Page 88 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation ATank Status: 30-000-006057-000002SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-016418Board Of Equalization: 9Number: 6057Comp Number: ActiveStatus: 2Number Of Tanks: DIESELContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 1000Capacity: ATank Status: 30-000-006057-000001SWRCB Tank Id: Not reportedOwner Tank Id: 02-29-88Created Date: 09-15-92Action Date: 09-30-92Referral Date: 44-016418Board Of Equalization: 9Number: 6057Comp Number: ActiveStatus: SWEEPS UST: Not reportedSummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MUNBeneficial: Not reportedHydr Basin #: 30000LLocal Agency: Local AgencyLead Agency: ARStaff Initials: NOMStaff: *MTBE Class: MTBE Detected. Site tested for MTBE & MTBE detectedMTBE Tested: 0MTBE Fuel: .4Max MTBE Soil: 0MTBE Concentration: 1120Max MTBE GW: 6/23/2003MTBE Date: -118.0458325Longitude: 33.8104537Latitude: LUSTOversite Program: Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: =Soil Qualifies: =GW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: Not reportedDate Remedial Action Underway: ORANGE COUNTY FIRE STATION #17 (Continued) U002096241 TC5646263.2s Page 89 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 083003072TReg Id: LTNKAReg By: 30Facility County Code: CORTESERegion: HIST CORTESE: ActiveStatus: Not reportedComments: Not reportedEPA ID: Not reportedNPDES Number: Not reportedDUNs Number: Not reportedContact Phone: Not reportedContact: CYPRESS 90630Mailing City,St,Zip: Not reportedMailing Address 2: 5275 ORANGE AVEMailing Address: Not reportedMail To: 7147440400Facility Phone: Not reportedSIC Code: Not reportedCortese Code: Not reportedRegulated ID: UTNKARegulated By: 30017524Facility ID: CA FID UST: Not reportedNumber Of Tanks: REG UNLEADEDContent: PSTG: M.V. FUELTank Use: Not reportedActive Date: 550Capacity: ORANGE COUNTY FIRE STATION #17 (Continued) U002096241 NONE SPECIFIEDSite Mgmt Req: NORestricted Use: Not reportedSpecial Program: Not reportedSenate: Not reportedAssembly: Cleanup CypressDivision Branch: Robert SengaSupervisor: Violeta MislangProgram Manager: SMBRPLead Agency: SMBRPRegulatory Agencies: NONPL: 0.5Acres: Tiered PermitSite Type Detailed: Tiered PermitSite Type: Not reportedSite Code: 09/17/2018Status Date: ActiveStatus: 60002729Facility ID: ENVIROSTOR: 2241 ft. 0.424 mi. Relative: Higher Actual: 37 ft. 1/4-1/2 CIWQSCYPRESS, CA 90630 ESE HAZNET5730 KATELLA AVE N/A 37 ENVIROSTORR & D BLDG PARCEL 7 S121666303 TC5646263.2s Page 90 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation CYPRESS, CA 906300000Mailing City,St,Zip: 5730 KATELLA AVENUEMailing Address: Not reportedMailing Name: 6573376542Telephone: ROBERT HAYSContact: CAL000415727GEPAID: 2017Year: ROLLS-ROYCE HIGH TEMPERATURE COMPOSITESSite Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Other inorganic solid wasteCat Decode: 0.357Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other inorganic solid wasteWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 906300000Mailing City,St,Zip: 5730 KATELLA AVENUEMailing Address: Not reportedMailing Name: 6573376542Telephone: ROBERT HAYSContact: CAL000415727GEPAID: 2017Year: ROLLS-ROYCE HIGH TEMPERATURE COMPOSITESSite Name: HAZNET: Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: 09/17/2018Completed Date: Phase 1Completed Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 60002729Alias Name: NONE SPECIFIEDPotential Description: NONE SPECIFIEDConfirmed COC: NONE SPECIFIEDPotential COC: NONE SPECIFIEDPast Use: NONE SPECIFIEDAPN: 0Longitude: 0Latitude: Responsible PartyFunding: R & D BLDG PARCEL 7 (Continued)S121666303 TC5646263.2s Page 91 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 6573376542Telephone: ROBERT HAYSContact: CAL000415727GEPAID: 2017Year: ROLLS-ROYCE HIGH TEMPERATURE COMPOSITESSite Name: OrangeFacility County: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Method Decode: Waste oil and mixed oilCat Decode: 1.03Tons: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Disposal Method: Waste oil and mixed oilWaste Category: Los AngelesTSD County: CAT080013352TSD EPA ID: OrangeGen County: CYPRESS, CA 906300000Mailing City,St,Zip: 5730 KATELLA AVENUEMailing Address: Not reportedMailing Name: 6573376542Telephone: ROBERT HAYSContact: CAL000415727GEPAID: 2017Year: ROLLS-ROYCE HIGH TEMPERATURE COMPOSITESSite Name: OrangeFacility County: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Method Decode: Unspecified aqueous solutionCat Decode: 0.1495Tons: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Disposal Method: Unspecified aqueous solutionWaste Category: Los AngelesTSD County: CAT080013352TSD EPA ID: OrangeGen County: CYPRESS, CA 906300000Mailing City,St,Zip: 5730 KATELLA AVENUEMailing Address: Not reportedMailing Name: 6573376542Telephone: ROBERT HAYSContact: CAL000415727GEPAID: 2017Year: ROLLS-ROYCE HIGH TEMPERATURE COMPOSITESSite Name: OrangeFacility County: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Method Decode: Unspecified organic liquid mixtureCat Decode: 0.5245Tons: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Disposal Method: Unspecified organic liquid mixtureWaste Category: Los AngelesTSD County: CAT080013352TSD EPA ID: OrangeGen County: R & D BLDG PARCEL 7 (Continued)S121666303 TC5646263.2s Page 92 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation -118.033351Longitude: 33.802917Latitude: 0Violations within 5 years: 0Enforcement Actions within 5 years: Not reportedTTWQ: Not reportedComplexity: Not reportedMajor/Minor: Not reportedDesign Flow: Not reportedExpiration/Review Date: 01/15/2002Termination Date: 03/14/2001Effective Date: Not reportedAdoption Date: CAS000002NPDES Number: 8 30C315253WDID: 99-08DWOrder Number: Storm water constructionRegulatory Measure Type: TerminatedRegulatory Measure Status: CONSTWProgram: 8Region: Not reportedSIC/NAICS: Construction - Commercial, Utility, IndustrialPlace/Project Type: 1299 Ocean Ave Ste 300, Santa Monica, CA 90401Agency Address: Warland Investment CoAgency: CIWQS: 2 additional CA_HAZNET: record(s) in the EDR Site Report. Click this hyperlink while viewing on your computer to access OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Unspecified oil-containing wasteCat Decode: 0.2175Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Unspecified oil-containing wasteWaste Category: 99TSD County: AZD081705402TSD EPA ID: OrangeGen County: CYPRESS, CA 906300000Mailing City,St,Zip: 5730 KATELLA AVENUEMailing Address: Not reportedMailing Name: R & D BLDG PARCEL 7 (Continued)S121666303 0Acres: EvaluationSite Type Detailed: EvaluationSite Type: Not reportedSite Code: 01/11/2011Status Date: Refer: Local AgencyStatus: 30370008Facility ID: ENVIROSTOR: 3609 ft. Site 1 of 2 in cluster H 0.684 mi.CIWQS Relative: Lower Actual: 28 ft. 1/2-1 HAZNETLOS ALAMITOS, CA 90720 West EMI4411 KATELLA AV N/A H38 ENVIROSTORVESPER CORP S101481470 TC5646263.2s Page 93 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Facility should be permitted. NFA by SMB. every 90 days. This is stored in 55 gal drums in storage yard. generates approx. 165 gals. of used degreas. containing 95% PCE, manufactured metal and non-metal ducting for aircraft. The facility facility sold to present owner, Vesper Corp. Arrowhead Products Corp. In 1983, facility was purchased by Indian Bar Co. In 1987, operations in 1961 as the Arrowhead Products Div. of Federal-Mogul SSI Report was reviewed by Region 4 staff. The facility beganComments: 02/14/1992Completed Date: Site ScreeningCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Database Validation Program confirms NFA for DTSC.Comments: 10/28/1994Completed Date: Site ScreeningCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: MFG. WASTES NOW SEWERED, RECYCLED OR LDFL FACILITY IDENTIFIED ID PHONE BOOK MFG CHEMS IN 1966. AIRCRAFT EQUIPComments: 08/01/1981Completed Date: * DiscoveryCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 30370008Alias Name: EPA (FRS #)Alias Type: 110000475888Alias Name: EPA Identification NumberAlias Type: CAD982360349Alias Name: EPA Identification NumberAlias Type: CAD008302002Alias Name: Alternate NameAlias Type: ARROWHEAD PRODUCTS COMPANYAlias Name: NONE SPECIFIEDPotential Description: NONE SPECIFIEDConfirmed COC: UNSPECIFIED SOLVENT MIXTURES (ACM * UNSPECIFIED ACID SOLUTION * UNSPECIFIED AQUEOUS SOLUTION * * ALKALINE SOLUTION WITHOUT METALS Asbestos Containing MaterialsPotential COC: NONE SPECIFIEDPast Use: NONE SPECIFIEDAPN: -118.0553Longitude: 33.80358Latitude: Not reportedFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: EPA - PASISpecial Program: 34Senate: 72Assembly: Cleanup CypressDivision Branch: Manny AlonzoSupervisor: Not reportedProgram Manager: US EPALead Agency: US EPARegulatory Agencies: NONPL: VESPER CORP (Continued)S101481470 TC5646263.2s Page 94 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 7Reactive Organic Gases Tons/Yr: 22Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1990Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 16Reactive Organic Gases Tons/Yr: 34Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 42954Facility ID: SCAir Basin: 30County Code: 1987Year: EMI: Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: 04/24/2009Completed Date: PA/SI Site ScreeningCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: RECOMMEND SCREENING SITE INSPECTION (HIGH PRIORITY). SITE SCREENING DONE EPA COMPLETED PRELIMINARY ASSESSMENT ANDComments: 03/22/1990Completed Date: Site ScreeningCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: VESPER CORP (Continued)S101481470 TC5646263.2s Page 95 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1998Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 10Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1997Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 8Reactive Organic Gases Tons/Yr: 13Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1996Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 7Reactive Organic Gases Tons/Yr: 18Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1995Year: VESPER CORP (Continued)S101481470 TC5646263.2s Page 96 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0Carbon Monoxide Emissions Tons/Yr: 6Reactive Organic Gases Tons/Yr: 10Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2001Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 10Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2000Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 10Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 1999Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 9Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: VESPER CORP (Continued)S101481470 TC5646263.2s Page 97 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 2005Year: 0.03Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.05375101Particulate Matter Tons/Yr: 0.00307SOX - Oxides of Sulphur Tons/Yr: 0.481NOX - Oxides of Nitrogen Tons/Yr: 0.13Carbon Monoxide Emissions Tons/Yr: 4.91Reactive Organic Gases Tons/Yr: 5.015527Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2004Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 0NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 5Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2003Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 0NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 5Reactive Organic Gases Tons/Yr: 5Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2002Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 1NOX - Oxides of Nitrogen Tons/Yr: VESPER CORP (Continued)S101481470 TC5646263.2s Page 98 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2011Year: 3.6899599999999998E-2Part. Matter 10 Micrometers and Smllr Tons/Yr: 3.6900000000000002E-2Particulate Matter Tons/Yr: 2.9099999999999998E-3SOX - Oxides of Sulphur Tons/Yr: 0.48549999999999999NOX - Oxides of Nitrogen Tons/Yr: 0.40782000000000002Carbon Monoxide Emissions Tons/Yr: 5.64642Reactive Organic Gases Tons/Yr: 6.1521856599770297Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2010Year: 3.0010559999999999E-2Part. Matter 10 Micrometers and Smllr Tons/Yr: 3.0010999999999999E-2Particulate Matter Tons/Yr: 2.6099999999999999E-3SOX - Oxides of Sulphur Tons/Yr: 0.42999999999999999NOX - Oxides of Nitrogen Tons/Yr: 0.35999999999999999Carbon Monoxide Emissions Tons/Yr: 5.3820839999999999Reactive Organic Gases Tons/Yr: 5.9953857988110197Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2009Year: .034533748777Part. Matter 10 Micrometers and Smllr Tons/Yr: .05554629Particulate Matter Tons/Yr: .00234SOX - Oxides of Sulphur Tons/Yr: .389NOX - Oxides of Nitrogen Tons/Yr: .327Carbon Monoxide Emissions Tons/Yr: 4.623030248Reactive Organic Gases Tons/Yr: 4.74276Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: VESPER CORP (Continued)S101481470 TC5646263.2s Page 99 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0.43118NOX - Oxides of Nitrogen Tons/Yr: 0.17954Carbon Monoxide Emissions Tons/Yr: 6.74688Reactive Organic Gases Tons/Yr: 8.1440901619Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2014Year: 0.0386576Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.03866Particulate Matter Tons/Yr: 0.00304SOX - Oxides of Sulphur Tons/Yr: 0.25298NOX - Oxides of Nitrogen Tons/Yr: 0.42672Carbon Monoxide Emissions Tons/Yr: 4.7126200008Reactive Organic Gases Tons/Yr: 5.5290276772Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2013Year: 0.0385096Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.03851Particulate Matter Tons/Yr: 0.00304SOX - Oxides of Sulphur Tons/Yr: 0.5067NOX - Oxides of Nitrogen Tons/Yr: 0.42562Carbon Monoxide Emissions Tons/Yr: 5.4762700052Reactive Organic Gases Tons/Yr: 6.613982224Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2012Year: 0.0379196Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.03792Particulate Matter Tons/Yr: 0.00299SOX - Oxides of Sulphur Tons/Yr: 0.49891NOX - Oxides of Nitrogen Tons/Yr: 0.41908Carbon Monoxide Emissions Tons/Yr: 5.41397Reactive Organic Gases Tons/Yr: 6.5007767986Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: VESPER CORP (Continued)S101481470 TC5646263.2s Page 100 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Other inorganic solid wasteCat Decode: 0.8Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other inorganic solid wasteWaste Category: 99TSD County: AZR000501510TSD EPA ID: OrangeGen County: LOS ALAMITOS, CA 907203514Mailing City,St,Zip: 4411 KATELLA AVEMailing Address: Not reportedMailing Name: 7148222655Telephone: LANE CROSSContact: CAD008302002GEPAID: 2017Year: ARROWHEAD PRODUCTS CORPORATIONSite Name: HAZNET: 0.020395012Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.021341Particulate Matter Tons/Yr: 0.001824SOX - Oxides of Sulphur Tons/Yr: 0.34447NOX - Oxides of Nitrogen Tons/Yr: 0.099805Carbon Monoxide Emissions Tons/Yr: 8.5639625Reactive Organic Gases Tons/Yr: 10.903495734Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2016Year: 0.042005279488Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.042778012Particulate Matter Tons/Yr: 0.003036SOX - Oxides of Sulphur Tons/Yr: 0.44582315NOX - Oxides of Nitrogen Tons/Yr: 0.183758Carbon Monoxide Emissions Tons/Yr: 24.93715181Reactive Organic Gases Tons/Yr: 26.640775316Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3728SIC Code: SCAir District Name: 58876Facility ID: SCAir Basin: 30County Code: 2015Year: 0.03979368Part. Matter 10 Micrometers and Smllr Tons/Yr: 0.04052Particulate Matter Tons/Yr: 0.00294SOX - Oxides of Sulphur Tons/Yr: VESPER CORP (Continued)S101481470 TC5646263.2s Page 101 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0.47955Tons: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Disposal Method: Unspecified alkaline solutionWaste Category: 99TSD County: NVT330010000TSD EPA ID: OrangeGen County: LOS ALAMITOS, CA 907203514Mailing City,St,Zip: 4411 KATELLA AVEMailing Address: Not reportedMailing Name: 7148222655Telephone: LANE CROSSContact: CAD008302002GEPAID: 2017Year: ARROWHEAD PRODUCTS CORPORATIONSite Name: OrangeFacility County: Blending) Energy Recovery At This Site--Use As Fuel(Includes On-Site FuelMethod Decode: Laboratory waste chemicalsCat Decode: 0.125Tons: Blending) Energy Recovery At This Site--Use As Fuel(Includes On-Site FuelDisposal Method: Laboratory waste chemicalsWaste Category: Not reportedTSD County: MXC130619001TSD EPA ID: OrangeGen County: LOS ALAMITOS, CA 907203514Mailing City,St,Zip: 4411 KATELLA AVEMailing Address: Not reportedMailing Name: 7148222655Telephone: LANE CROSSContact: CAD008302002GEPAID: 2017Year: ARROWHEAD PRODUCTS CORPORATIONSite Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Other empty containers 30 gallons or moreCat Decode: 0.015Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other empty containers 30 gallons or moreWaste Category: 99TSD County: AZR000501510TSD EPA ID: OrangeGen County: LOS ALAMITOS, CA 907203514Mailing City,St,Zip: 4411 KATELLA AVEMailing Address: Not reportedMailing Name: 7148222655Telephone: LANE CROSSContact: CAD008302002GEPAID: 2017Year: ARROWHEAD PRODUCTS CORPORATIONSite Name: OrangeFacility County: VESPER CORP (Continued)S101481470 TC5646263.2s Page 102 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation -118.05555Longitude: 33.80314Latitude: 0Violations within 5 years: 0Enforcement Actions within 5 years: Not reportedTTWQ: Not reportedComplexity: Not reportedMajor/Minor: Not reportedDesign Flow: Not reportedExpiration/Review Date: Not reportedTermination Date: 03/26/1992Effective Date: Not reportedAdoption Date: CAS000001NPDES Number: 8 30I001207WDID: 2014-0057-DWQOrder Number: Storm water industrialRegulatory Measure Type: ActiveRegulatory Measure Status: INDSTWProgram: 8Region: MultipleSIC/NAICS: Industrial - Aircraft Parts and Auxiliary Equipment, NECPlace/Project Type: 4411 Katella Ave, Los Alamitos, CA 90720Agency Address: Arrowhead ProductsAgency: CIWQS: 524 additional CA_HAZNET: record(s) in the EDR Site Report. Click this hyperlink while viewing on your computer to access OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Aqueous solution with metals (< restricted levels and (Alkaline solution (pH >= 12.5) with metals))Cat Decode: 0.06255Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: solution (pH >= 12.5) with metals)) Aqueous solution with metals (< restricted levels and (AlkalineWaste Category: 99TSD County: NVT330010000TSD EPA ID: OrangeGen County: LOS ALAMITOS, CA 907203514Mailing City,St,Zip: 4411 KATELLA AVEMailing Address: Not reportedMailing Name: 7148222655Telephone: LANE CROSSContact: CAD008302002GEPAID: 2017Year: ARROWHEAD PRODUCTS CORPORATIONSite Name: OrangeFacility County: Organics Recovery Ect Other Recovery Of Reclamation For Reuse Including Acid Regeneration,Method Decode: Unspecified alkaline solutionCat Decode: VESPER CORP (Continued)S101481470 TC5646263.2s Page 103 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Phase 1Completed Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 12/13/2018Completed Date: Annual Oversight Cost EstimateCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 11/02/2017Completed Date: Annual Oversight Cost EstimateCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 08/08/2017Completed Date: Consent AgreementCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 60002104Alias Name: Project Code (Site Code)Alias Type: 401772Alias Name: SOILPotential Description: 30001-NO 30152-NO 30156-NOConfirmed COC: Arsenic Chromium III Copper and compoundsPotential COC: AEROSPACE MANUFACTURING/MAINTENANCEPast Use: NONE SPECIFIEDAPN: -118.0554Longitude: 33.80408Latitude: Responsible PartyFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: Not reportedSpecial Program: 34Senate: 72Assembly: Cleanup CypressDivision Branch: Robert SengaSupervisor: Violeta MislangProgram Manager: SMBRPLead Agency: SMBRPRegulatory Agencies: NONPL: 0.5Acres: Tiered PermitSite Type Detailed: Tiered PermitSite Type: 401772Site Code: 09/23/2014Status Date: ActiveStatus: 60002104Facility ID: ENVIROSTOR: 3609 ft. Site 2 of 2 in cluster H 0.684 mi. Relative: Lower Actual: 28 ft. 1/2-1 LOS ALAMITOS, CA 90720 West 4411 KATELLA AVENUE N/A H39 ENVIROSTORARROWHEAD PRODUCTS S117038742 TC5646263.2s Page 104 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: 2019Future Due Date: Supplemental Site Investigation ReportFuture Document Type: Not reportedFuture Sub Area Name: PROJECT WIDEFuture Area Name: Not reportedComments: 09/15/2016Completed Date: Phase I VerificationCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 04/03/2018Completed Date: FieldworkCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 11/29/2018Completed Date: Preliminary Endangerment Assessment ReportCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 01/30/2018Completed Date: Preliminary Endangerment Assessment WorkplanCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 09/25/2014Completed Date: ARROWHEAD PRODUCTS (Continued) S117038742 34Senate: 72Assembly: NONE SPECIFIEDSite Mgmt. Req.: 400332Site Code: Cleanup CypressDivision Branch: Robert SengaSupervisor: Not reportedProject Manager: RWQCB 8 - Santa AnaLead Agency Description: RWQCB 8 - Santa AnaCleanup Oversight Agencies: NONational Priorities List: 1549Acres: FUDSSite Type Detail: State ResponseSite Type: 30490037Facility ID: RESPONSE: 3628 ft. 0.687 mi. Relative: Lower Actual: 27 ft. 1/2-1 LUSTLOS ALAMITOS, CA 90720 WSW ENVIROSTOR4250 CONSTITUTION AVE N/A 40 RESPONSEJOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 S106387296 TC5646263.2s Page 105 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 04/27/1995Completed Date: Preliminary Endangerment Assessment ReportCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 02/15/1996Completed Date: Removal Action Completion ReportCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 30490037Alias Name: Project Code (Site Code)Alias Type: 400332Alias Name: HWTS Identification CodeAlias Type: CA8572890517Alias Name: GeoTracker Global IDAlias Type: T060653541Alias Name: GeoTracker Global IDAlias Type: T0605969865Alias Name: GeoTracker Global IDAlias Type: T0605960022Alias Name: GeoTracker Global IDAlias Type: T0605926698Alias Name: GeoTracker Global IDAlias Type: T060592093Alias Name: GeoTracker Global IDAlias Type: T0605912556Alias Name: GeoTracker Global IDAlias Type: T0605911429Alias Name: GeoTracker Global IDAlias Type: T0605901297Alias Name: GeoTracker Global IDAlias Type: T0605900572Alias Name: GeoTracker Global IDAlias Type: T0605900553Alias Name: EPA (FRS #)Alias Type: 110033606774Alias Name: Alternate NameAlias Type: LOS ALAMITOS AFRCAlias Name: Alternate NameAlias Type: ARMED FORCES RESERVE CENTER LOS ALAMITOSAlias Name: SOILPotential Description: 31000-NO 30051-NO 32000-NO 30580-NO 30581-NO 30582-NO 30594-NO 30013-NOConfirmed COC: Trinitrophenylmethylnitramine 2,4,6-Trinitrotoluene Zinc Munitions Debris (MD Lead Aminodinitrotoluene 1,3,5-TrinitrobenzenePotential COC : FIRE TRAINING AREAS, FIRING RANGE - SMALL ARMS ETC...Past Use: NONE SPECIFIEDAPN: -118.0547Longitude: 33.79916Latitude: DERAFunding: NORestricted Use: 02/03/2010Status Date: No Further ActionStatus: DSMOASpecial Program Status: JOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 (Continued) S106387296 TC5646263.2s Page 106 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Trinitrophenylmethylnitramine 2,4,6-Trinitrotoluene Zinc Munitions Debris (MD Lead Aminodinitrotoluene 1,3,5-TrinitrobenzenePotential COC: FIRE TRAINING AREAS, FIRING RANGE - SMALL ARMS ETC...Past Use: NONE SPECIFIEDAPN: -118.0547Longitude: 33.79916Latitude: DERAFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: DSMOASpecial Program: 34Senate: 72Assembly: Cleanup CypressDivision Branch: Robert SengaSupervisor: Not reportedProgram Manager: RWQCB 8 - Santa AnaLead Agency: RWQCB 8 - Santa AnaRegulatory Agencies: NONPL: 1549Acres: FUDSSite Type Detailed: State ResponseSite Type: 400332Site Code: 02/03/2010Status Date: No Further ActionStatus: 30490037Facility ID: ENVIROSTOR: Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: 04/21/1997Completed Date: *Action Memorandum (if <$1M)Completed Document Type: SITE9Completed Sub Area Name: Sites With No Operable UnitCompleted Area Name: available . information indicating that this decision was not appropriate becomes has determined that no further evaluation will be taken unless recommendation statement that to the best of our knowledge, the Army program. Furthermore, DTSC agrees with the Army s conclusions and ineligibility for the active army military munitions response Evaluation Accomplished for the Phelan Small Arms Range and the range DTSC agreed with the reports recommendation of Interim SiteComments: 09/03/2008Completed Date: Preliminary Assessment/Site Inspection Report (PA/SI)Completed Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: JOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 (Continued) S106387296 TC5646263.2s Page 107 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation recommendation statement that to the best of our knowledge, the Army program. Furthermore, DTSC agrees with the Army s conclusions and ineligibility for the active army military munitions response Evaluation Accomplished for the Phelan Small Arms Range and the range DTSC agreed with the reports recommendation of Interim SiteComments: 09/03/2008Completed Date: Preliminary Assessment/Site Inspection Report (PA/SI)Completed Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 04/27/1995Completed Date: Preliminary Endangerment Assessment ReportCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 02/15/1996Completed Date: Removal Action Completion ReportCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 30490037Alias Name: Project Code (Site Code)Alias Type: 400332Alias Name: HWTS Identification CodeAlias Type: CA8572890517Alias Name: GeoTracker Global IDAlias Type: T060653541Alias Name: GeoTracker Global IDAlias Type: T0605969865Alias Name: GeoTracker Global IDAlias Type: T0605960022Alias Name: GeoTracker Global IDAlias Type: T0605926698Alias Name: GeoTracker Global IDAlias Type: T060592093Alias Name: GeoTracker Global IDAlias Type: T0605912556Alias Name: GeoTracker Global IDAlias Type: T0605911429Alias Name: GeoTracker Global IDAlias Type: T0605901297Alias Name: GeoTracker Global IDAlias Type: T0605900572Alias Name: GeoTracker Global IDAlias Type: T0605900553Alias Name: EPA (FRS #)Alias Type: 110033606774Alias Name: Alternate NameAlias Type: LOS ALAMITOS AFRCAlias Name: Alternate NameAlias Type: ARMED FORCES RESERVE CENTER LOS ALAMITOSAlias Name: SOILPotential Description: 31000-NO 30051-NO 32000-NO 30580-NO 30581-NO 30582-NO 30594-NO 30013-NOConfirmed COC: JOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 (Continued) S106387296 TC5646263.2s Page 108 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedInterim: Not reportedFacility Contact: Not reportedOperator: Not reportedSoil Qualifies: =GW Qualifies: Not reportedEnter Date: Not reportedDate Post Remedial Action Monitoring: 4/17/1997Date Remedial Action Underway: Not reportedDate Remediation Plan Submitted: 10/2/1989Date Pollution Characterization Began: Not reportedDate Prelim Assessment Workplan Submitted: Not reportedClose Date: Not reportedEnforcement Date: 10/1/1987Discover Date: Not reportedDate Preliminary Assessment Began: Not reportedDate Confirmation of Leak Began: Not reportedEnter Date: 10/15/1987How Stopped Date: T0605912556Global ID: PipingLeak Source: CorrosionLeak Cause: Close TankHow Stopped: Tank ClosureHow Discovered: Not reportedFunding: Not reportedEnf Type: GETTYSBERGCross Street: Not reportedAbate Method: Not reportedQty Leaked: GasolineSubstance: Aquifer affectedCase Type: Not reportedLocal Case Num: 083003835TCase Number: Remedial action (cleanup) UnderwayFacility Status: Santa Ana RegionRegional Board: OrangeCounty: 8Region: LUST REG 8: Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: 04/21/1997Completed Date: *Action Memorandum (if <$1M)Completed Document Type: SITE9Completed Sub Area Name: Sites With No Operable UnitCompleted Area Name: available . information indicating that this decision was not appropriate becomes has determined that no further evaluation will be taken unless JOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 (Continued) S106387296 TC5646263.2s Page 109 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation SITE COVERED BY DVPE SYSTEM INSTALLED FOR BLDG 35 RELEASESummary: Not reportedWork Suspended: Not reportedCleanup Fund Id: Not reportedPriority: MS_TBeneficial: COASTAL PLAIN OF ORAHydr Basin #: 30000LLocal Agency: Regional BoardLead Agency: SASStaff Initials: JCBStaff: CMTBE Class: MTBE Detected. Site tested for MTBE & MTBE detectedMTBE Tested: 1MTBE Fuel: Not reportedMax MTBE Soil: 1MTBE Concentration: 9.7Max MTBE GW: 12/16/1999MTBE Date: -118.0578713Longitude: 33.7940899Latitude: DODOversite Program: JOINT FORCES TRAINING BASE, LOS ALAMITOS - BLDG 34 (Continued) S106387296 Completed Info: Envirostor ID NumberAlias Type: 30990005Alias Name: NONE SPECIFIEDPotential Description: NONE SPECIFIEDConfirmed COC: NONE SPECIFIEDPotential COC: NONE SPECIFIEDPast Use: NONE SPECIFIEDAPN: -118.0276Longitude: 33.80638Latitude: Not ApplicableFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: Not reportedSpecial Program: Not reportedSenate: 67Assembly: Cleanup CypressDivision Branch: Referred - Not AssignedSupervisor: Not reportedProgram Manager: NONE SPECIFIEDLead Agency: NONE SPECIFIEDRegulatory Agencies: NONPL: Not reportedAcres: EvaluationSite Type Detailed: EvaluationSite Type: Not reportedSite Code: 09/02/2004Status Date: Refer: 1248 Local AgencyStatus: 30990005Facility ID: ENVIROSTOR: 4017 ft. 0.761 mi.HAZNET Relative: Higher Actual: 39 ft. 1/2-1 EMICYPRESS, CA 90630 East Orange Co. Industrial Site10800 VALLEY VIEW ST N/A 41 ENVIROSTORTHE BOEING COMPANY S103622068 TC5646263.2s Page 110 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 0NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 1Reactive Organic Gases Tons/Yr: 1Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3599SIC Code: SCAir District Name: 23960Facility ID: SCAir Basin: 30County Code: 1990Year: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: 0Particulate Matter Tons/Yr: 0SOX - Oxides of Sulphur Tons/Yr: 0NOX - Oxides of Nitrogen Tons/Yr: 0Carbon Monoxide Emissions Tons/Yr: 4Reactive Organic Gases Tons/Yr: 5Total Organic Hydrocarbon Gases Tons/Yr: Not reportedConsolidated Emission Reporting Rule: Not reportedCommunity Health Air Pollution Info System: SOUTH COAST AQMDAir District Name: 3444SIC Code: SCAir District Name: 23960Facility ID: SCAir Basin: 30County Code: 1987Year: EMI: OIL AND WATERReleased Chemical: Closure certification issuedClosure Type: CLOSED 1/27/2005Current Status: RO0003315Record ID: 04IC015Case ID: Orange Co. Industrial Site: Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: Not reportedCompleted Date: Not reportedCompleted Document Type: Not reportedCompleted Sub Area Name: Not reportedCompleted Area Name: THE BOEING COMPANY (Continued) S103622068 TC5646263.2s Page 111 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Unspecified oil-containing wasteWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 90630Mailing City,St,Zip: 10800 VALLEY VIEW STMailing Address: Not reportedMailing Name: 5628461638Telephone: MICHAEL PEREZContact: CAL000421273GEPAID: 2016Year: COOK COMPRESSION A DOVER COMPANYSite Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Other inorganic solid wasteCat Decode: 0.225Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Other inorganic solid wasteWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 90630Mailing City,St,Zip: 10800 VALLEY VIEW STMailing Address: Not reportedMailing Name: 5628461638Telephone: MICHAEL PEREZContact: CAL000421273GEPAID: 2017Year: COOK COMPRESSION A DOVER COMPANYSite Name: OrangeFacility County: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryMethod Decode: Unspecified oil-containing wasteCat Decode: 0.3Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Unspecified oil-containing wasteWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 90630Mailing City,St,Zip: 10800 VALLEY VIEW STMailing Address: Not reportedMailing Name: 5628461638Telephone: MICHAEL PEREZContact: CAL000421273GEPAID: 2017Year: COOK COMPRESSION A DOVER COMPANYSite Name: HAZNET: 0Part. Matter 10 Micrometers and Smllr Tons/Yr: THE BOEING COMPANY (Continued) S103622068 TC5646263.2s Page 112 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation additional CA_HAZNET: detail in the EDR Site Report. Click this hyperlink while viewing on your computer to access OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.2Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Unspecified oil-containing wasteWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 906305016Mailing City,St,Zip: 10800 VALLEY VIEW STMailing Address: Not reportedMailing Name: 5628461638Telephone: MIKE PEREZContact: CAC002870235GEPAID: 2016Year: COOK COMPRESSIONSite Name: OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.72975Tons: (H010-H129) Or (H131-H135) Storage, Bulking, And/Or Transfer Off Site--No Treatment/ReoveryDisposal Method: Oil/water separation sludgeWaste Category: Los AngelesTSD County: CAD044429835TSD EPA ID: OrangeGen County: CYPRESS, CA 90630Mailing City,St,Zip: 10800 VALLEY VIEW STMailing Address: Not reportedMailing Name: 5628461638Telephone: MICHAEL PEREZContact: CAL000421273GEPAID: 2016Year: COOK COMPRESSION A DOVER COMPANYSite Name: OrangeFacility County: Not reportedMethod Decode: Not reportedCat Decode: 0.1Tons: THE BOEING COMPANY (Continued) S103622068 Military EvaluationSite Type: Not reportedSite Code: 08/14/2018Status Date: Inactive - Needs EvaluationStatus: 80000425Facility ID: ENVIROSTOR: 5050 ft. Site 1 of 2 in cluster I 0.956 mi. Relative: Lower Actual: 26 ft. 1/2-1 LOS ALAMITOS, CA SW N/A I42 ENVIROSTORLOS ALAMITOS RAD BOMB/SCORE SITE S107737117 TC5646263.2s Page 113 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Draft Site visit report on R drive for management review.Comments: 07/17/2017Completed Date: Site ScreeningCompleted Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Not reportedComments: 02/24/1993Completed Date: Inventory Project Report (INPR)Completed Document Type: Not reportedCompleted Sub Area Name: PROJECT WIDECompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 80000425Alias Name: INPRAlias Type: J09CA0561Alias Name: Federal Facility IDAlias Type: CA99799F557100Alias Name: NONE SPECIFIEDPotential Description: NONE SPECIFIEDConfirmed COC: Explosives (UXO, MECPotential COC: NONE SPECIFIEDPast Use: NONE SPECIFIEDAPN: -118.0527Longitude: 33.79166Latitude: DERAFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: Not reportedSpecial Program: 34Senate: 72Assembly: Cleanup CypressDivision Branch: Patrick HsiehSupervisor: Not reportedProgram Manager: SMBRPLead Agency: SMBRPRegulatory Agencies: NONPL: 10Acres: FUDSSite Type Detailed: LOS ALAMITOS RAD BOMB/SCORE SITE (Continued) S107737117 TC5646263.2s Page 114 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedSchedule Revised Date: Not reportedSchedule Due Date: Not reportedSchedule Document Type: Not reportedSchedule Sub Area Name: Not reportedSchedule Area Name: Not reportedFuture Due Date: Not reportedFuture Document Type: Not reportedFuture Sub Area Name: Not reportedFuture Area Name: Not reportedComments: Not reportedCompleted Date: Not reportedCompleted Document Type: Not reportedCompleted Sub Area Name: Not reportedCompleted Area Name: Completed Info: Envirostor ID NumberAlias Type: 80000646Alias Name: INPRAlias Type: J09CA1044Alias Name: Federal Facility IDAlias Type: CA99799F593900Alias Name: NONE SPECIFIEDPotential Description: NONE SPECIFIEDConfirmed COC: NONE SPECIFIEDPotential COC: NONE SPECIFIEDPast Use: NONE SPECIFIEDAPN: -118.0527Longitude: 33.79166Latitude: DERAFunding: NONE SPECIFIEDSite Mgmt Req: NORestricted Use: Not reportedSpecial Program: 34Senate: 72Assembly: Cleanup CypressDivision Branch: Douglas BautistaSupervisor: Not reportedProgram Manager: SMBRPLead Agency: SMBRPRegulatory Agencies: NONPL: Not reportedAcres: FUDSSite Type Detailed: Military EvaluationSite Type: Not reportedSite Code: 07/01/2005Status Date: Inactive - Needs EvaluationStatus: 80000646Facility ID: ENVIROSTOR: 5050 ft. Site 2 of 2 in cluster I 0.956 mi. Relative: Lower Actual: 26 ft. 1/2-1 LOS ALAMITOS, CA SW N/A I43 ENVIROSTORNAS LOS ALAMITOS S107736812 TC5646263.2s Page 115 ORPHAN SUMMARYCityEDR IDSite NameSite AddressZipDatabase(s)Count: 1 records.LOS ALAMITOS S121699767BENJAMIN B & MARIA L BARAJAS DBANE CRN LOS ALAMITOS & KATELLA90720DRYCLEANERSTC5646263.2s Page 116 To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required. Number of Days to Update:Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public. STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL: National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon coverage for over 1,000 NPL site boundaries produced by EPA’s Environmental Photographic Interpretation Center (EPIC) and regional EPA offices. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 18 Source: EPA Telephone: N/A Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly NPL Site Boundaries Sources: EPA’s Environmental Photographic Interpretation Center (EPIC) Telephone: 202-564-7333 EPA Region 1 EPA Region 6 Telephone 617-918-1143 Telephone: 214-655-6659 EPA Region 3 EPA Region 7 Telephone 215-814-5418 Telephone: 913-551-7247 EPA Region 4 EPA Region 8 Telephone 404-562-8033 Telephone: 303-312-6774 EPA Region 5 EPA Region 9 Telephone 312-886-6686 Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL: Proposed National Priority List Sites A site that has been proposed for listing on the National Priorities List through the issuance of a proposed rule in the Federal Register. EPA then accepts public comments on the site, responds to the comments, and places on the NPL those sites that continue to meet the requirements for listing. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 18 Source: EPA Telephone: N/A Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly NPL LIENS: Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority to file liens against real property in order to recover remedial action expenditures or when the property owner received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens. TC5646263.2s Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994 Date Made Active in Reports: 03/30/1994 Number of Days to Update: 56 Source: EPA Telephone: 202-564-4267 Last EDR Contact: 08/15/2011 Next Scheduled EDR Contact: 11/28/2011 Data Release Frequency: No Update Planned Federal Delisted NPL site list Delisted NPL: National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the NPL where no further response is appropriate. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 18 Source: EPA Telephone: N/A Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly Federal CERCLIS list FEDERAL FACILITY: Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities Restoration and Reuse Office is involved in cleanup activities. Date of Government Version: 11/07/2016 Date Data Arrived at EDR: 01/05/2017 Date Made Active in Reports: 04/07/2017 Number of Days to Update: 92 Source: Environmental Protection Agency Telephone: 703-603-8704 Last EDR Contact: 04/05/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Varies SEMS: Superfund Enterprise Management System SEMS (Superfund Enterprise Management System) tracks hazardous waste sites, potentially hazardous waste sites, and remedial activities performed in support of EPA’s Superfund Program across the United States. The list was formerly know as CERCLIS, renamed to SEMS by the EPA in 2015. The list contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities, private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA). This dataset also contains sites which are either proposed to or on the National Priorities List (NPL) and the sites which are in the screening and assessment phase for possible inclusion on the NPL. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 34 Source: EPA Telephone: 800-424-9346 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Quarterly Federal CERCLIS NFRAP site list SEMS-ARCHIVE: Superfund Enterprise Management System Archive TC5646263.2s Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING SEMS-ARCHIVE (Superfund Enterprise Management System Archive) tracks sites that have no further interest under the Federal Superfund Program based on available information. The list was formerly known as the CERCLIS-NFRAP, renamed to SEMS ARCHIVE by the EPA in 2015. EPA may perform a minimal level of assessment work at a site while it is archived if site conditions change and/or new information becomes available. Archived sites have been removed and archived from the inventory of SEMS sites. Archived status indicates that, to the best of EPA’s knowledge, assessment at a site has been completed and that EPA has determined no further steps will be taken to list the site on the National Priorities List (NPL), unless information indicates this decision was not appropriate or other considerations require a recommendation for listing at a later time. The decision does not necessarily mean that there is no hazard associated with a given site; it only means that. based upon available information, the location is not judged to be potential NPL site. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 34 Source: EPA Telephone: 800-424-9346 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list CORRACTS: Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: EPA Telephone: 800-424-9346 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDF: RCRA - Treatment, Storage and Disposal RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the waste. TSDFs treat, store, or dispose of the waste. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: Environmental Protection Agency Telephone: (415) 495-8895 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly Federal RCRA generators list RCRA-LQG: RCRA - Large Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: Environmental Protection Agency Telephone: (415) 495-8895 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly TC5646263.2s Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING RCRA-SQG: RCRA - Small Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate between 100 kg and 1,000 kg of hazardous waste per month. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: Environmental Protection Agency Telephone: (415) 495-8895 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly RCRA-CESQG: RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators (CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: Environmental Protection Agency Telephone: (415) 495-8895 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly Federal institutional controls / engineering controls registries LUCIS: Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure properties. Date of Government Version: 02/22/2019 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 41 Source: Department of the Navy Telephone: 843-820-7326 Last EDR Contact: 02/07/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Varies US ENG CONTROLS: Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental media or effect human health. Date of Government Version: 01/31/2019 Date Data Arrived at EDR: 02/04/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR Contact: 02/04/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies US INST CONTROL: Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures, such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally required as part of the institutional controls. Date of Government Version: 01/31/2019 Date Data Arrived at EDR: 02/04/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR Contact: 02/04/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies TC5646263.2s Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Federal ERNS list ERNS: Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous substances. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/26/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 36 Source: National Response Center, United States Coast Guard Telephone: 202-267-2180 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly State- and tribal - equivalent NPL RESPONSE: State Response Sites Identifies confirmed release sites where DTSC is involved in remediation, either in a lead or oversight capacity. These confirmed release sites are generally high-priority and high potential risk. Date of Government Version: 01/28/2019 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 35 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 04/30/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly State- and tribal - equivalent CERCLIS ENVIROSTOR: EnviroStor Database The Department of Toxic Substances Control’s (DTSC’s) Site Mitigation and Brownfields Reuse Program’s (SMBRP’s) EnviroStor database identifes sites that have known contamination or sites for which there may be reasons to investigate further. The database includes the following site types: Federal Superfund sites (National Priorities List (NPL)); State Response, including Military Facilities and State Superfund; Voluntary Cleanup; and School sites. EnviroStor provides similar information to the information that was available in CalSites, and provides additional site information, including, but not limited to, identification of formerly-contaminated properties that have been released for reuse, properties where environmental deed restrictions have been recorded to prevent inappropriate land uses, and risk characterization information that is used to assess potential impacts to public health and the environment at contaminated sites. Date of Government Version: 01/28/2019 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 35 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 04/30/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly State and tribal landfill and/or solid waste disposal site lists SWF/LF (SWIS): Solid Waste Information System Active, Closed and Inactive Landfills. SWF/LF records typically contain an inve ntory of solid waste disposal facilities or landfills. These may be active or i nactive facilities or open dumps that failed to meet RCRA Section 4004 criteria for solid waste landfills or disposal sites. Date of Government Version: 02/11/2019 Date Data Arrived at EDR: 02/12/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 21 Source: Department of Resources Recycling and Recovery Telephone: 916-341-6320 Last EDR Contact: 02/12/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Quarterly State and tribal leaking storage tank lists TC5646263.2s Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING LUST REG 5: Leaking Underground Storage Tank Database Leaking Underground Storage Tank locations. Alameda, Alpine, Amador, Butte, Colusa, Contra Costa, Calveras, El Dorado, Fresno, Glenn, Kern, Kings, Lake, Lassen, Madera, Mariposa, Merced, Modoc, Napa, Nevada, Placer, Plumas, Sacramento, San Joaquin, Shasta, Solano, Stanislaus, Sutter, Tehama, Tulare, Tuolumne, Yolo, Yuba counties. Date of Government Version: 07/01/2008 Date Data Arrived at EDR: 07/22/2008 Date Made Active in Reports: 07/31/2008 Number of Days to Update: 9 Source: California Regional Water Quality Control Board Central Valley Region (5) Telephone: 916-464-4834 Last EDR Contact: 07/01/2011 Next Scheduled EDR Contact: 10/17/2011 Data Release Frequency: No Update Planned LUST: Leaking Underground Fuel Tank Report (GEOTRACKER) Leaking Underground Storage Tank (LUST) Sites included in GeoTracker. GeoTracker is the Water Boards data management system for sites that impact, or have the potential to impact, water quality in California, with emphasis on groundwater. Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: see region list Last EDR Contact: 12/11/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Quarterly LUST REG 9: Leaking Underground Storage Tank Report Orange, Riverside, San Diego counties. For more current information, please refer to the State Water Resources Control Board’s LUST database. Date of Government Version: 03/01/2001 Date Data Arrived at EDR: 04/23/2001 Date Made Active in Reports: 05/21/2001 Number of Days to Update: 28 Source: California Regional Water Quality Control Board San Diego Region (9) Telephone: 858-637-5595 Last EDR Contact: 09/26/2011 Next Scheduled EDR Contact: 01/09/2012 Data Release Frequency: No Update Planned LUST REG 8: Leaking Underground Storage Tanks California Regional Water Quality Control Board Santa Ana Region (8). For more current information, please refer to the State Water Resources Control Board’s LUST database. Date of Government Version: 02/14/2005 Date Data Arrived at EDR: 02/15/2005 Date Made Active in Reports: 03/28/2005 Number of Days to Update: 41 Source: California Regional Water Quality Control Board Santa Ana Region (8) Telephone: 909-782-4496 Last EDR Contact: 08/15/2011 Next Scheduled EDR Contact: 11/28/2011 Data Release Frequency: Varies LUST REG 7: Leaking Underground Storage Tank Case Listing Leaking Underground Storage Tank locations. Imperial, Riverside, San Diego, Santa Barbara counties. Date of Government Version: 02/26/2004 Date Data Arrived at EDR: 02/26/2004 Date Made Active in Reports: 03/24/2004 Number of Days to Update: 27 Source: California Regional Water Quality Control Board Colorado River Basin Region (7) Telephone: 760-776-8943 Last EDR Contact: 08/01/2011 Next Scheduled EDR Contact: 11/14/2011 Data Release Frequency: No Update Planned LUST REG 6V: Leaking Underground Storage Tank Case Listing Leaking Underground Storage Tank locations. Inyo, Kern, Los Angeles, Mono, San Bernardino counties. Date of Government Version: 06/07/2005 Date Data Arrived at EDR: 06/07/2005 Date Made Active in Reports: 06/29/2005 Number of Days to Update: 22 Source: California Regional Water Quality Control Board Victorville Branch Office (6) Telephone: 760-241-7365 Last EDR Contact: 09/12/2011 Next Scheduled EDR Contact: 12/26/2011 Data Release Frequency: No Update Planned TC5646263.2s Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING LUST REG 6L: Leaking Underground Storage Tank Case Listing For more current information, please refer to the State Water Resources Control Board’s LUST database. Date of Government Version: 09/09/2003 Date Data Arrived at EDR: 09/10/2003 Date Made Active in Reports: 10/07/2003 Number of Days to Update: 27 Source: California Regional Water Quality Control Board Lahontan Region (6) Telephone: 530-542-5572 Last EDR Contact: 09/12/2011 Next Scheduled EDR Contact: 12/26/2011 Data Release Frequency: No Update Planned LUST REG 4: Underground Storage Tank Leak List Los Angeles, Ventura counties. For more current information, please refer to the State Water Resources Control Board’s LUST database. Date of Government Version: 09/07/2004 Date Data Arrived at EDR: 09/07/2004 Date Made Active in Reports: 10/12/2004 Number of Days to Update: 35 Source: California Regional Water Quality Control Board Los Angeles Region (4) Telephone: 213-576-6710 Last EDR Contact: 09/06/2011 Next Scheduled EDR Contact: 12/19/2011 Data Release Frequency: No Update Planned LUST REG 3: Leaking Underground Storage Tank Database Leaking Underground Storage Tank locations. Monterey, San Benito, San Luis Obispo, Santa Barbara, Santa Cruz counties. Date of Government Version: 05/19/2003 Date Data Arrived at EDR: 05/19/2003 Date Made Active in Reports: 06/02/2003 Number of Days to Update: 14 Source: California Regional Water Quality Control Board Central Coast Region (3) Telephone: 805-542-4786 Last EDR Contact: 07/18/2011 Next Scheduled EDR Contact: 10/31/2011 Data Release Frequency: No Update Planned LUST REG 2: Fuel Leak List Leaking Underground Storage Tank locations. Alameda, Contra Costa, Marin, Napa, San Francisco, San Mateo, Santa Clara, Solano, Sonoma counties. Date of Government Version: 09/30/2004 Date Data Arrived at EDR: 10/20/2004 Date Made Active in Reports: 11/19/2004 Number of Days to Update: 30 Source: California Regional Water Quality Control Board San Francisco Bay Region (2) Telephone: 510-622-2433 Last EDR Contact: 09/19/2011 Next Scheduled EDR Contact: 01/02/2012 Data Release Frequency: Quarterly LUST REG 1: Active Toxic Site Investigation Del Norte, Humboldt, Lake, Mendocino, Modoc, Siskiyou, Sonoma, Trinity counties. For more current information, please refer to the State Water Resources Control Board’s LUST database. Date of Government Version: 02/01/2001 Date Data Arrived at EDR: 02/28/2001 Date Made Active in Reports: 03/29/2001 Number of Days to Update: 29 Source: California Regional Water Quality Control Board North Coast (1) Telephone: 707-570-3769 Last EDR Contact: 08/01/2011 Next Scheduled EDR Contact: 11/14/2011 Data Release Frequency: No Update Planned INDIAN LUST R7: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 02/19/2019 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R8: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming. TC5646263.2s Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 10/16/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 8 Telephone: 303-312-6271 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R9: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 10/10/2018 Date Data Arrived at EDR: 03/08/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 54 Source: Environmental Protection Agency Telephone: 415-972-3372 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R10: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington. Date of Government Version: 10/17/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R5: Leaking Underground Storage Tanks on Indian Land Leaking underground storage tanks located on Indian Land in Michigan, Minnesota and Wisconsin. Date of Government Version: 10/12/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA, Region 5 Telephone: 312-886-7439 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R4: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina. Date of Government Version: 09/24/2018 Date Data Arrived at EDR: 03/12/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 50 Source: EPA Region 4 Telephone: 404-562-8677 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R6: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma. Date of Government Version: 11/01/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 6 Telephone: 214-665-6597 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN LUST R1: Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land. Date of Government Version: 10/13/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 1 Telephone: 617-918-1313 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies TC5646263.2s Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CPS-SLIC: Statewide SLIC Cases (GEOTRACKER) Cleanup Program Sites (CPS; also known as Site Cleanups [SC] and formerly known as Spills, Leaks, Investigations, and Cleanups [SLIC] sites) included in GeoTracker. GeoTracker is the Water Boards data management system for sites that impact, or have the potential to impact, water quality in California, with emphasis on groundwater. Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies SLIC REG 1: Active Toxic Site Investigations The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 04/03/2003 Date Data Arrived at EDR: 04/07/2003 Date Made Active in Reports: 04/25/2003 Number of Days to Update: 18 Source: California Regional Water Quality Control Board, North Coast Region (1) Telephone: 707-576-2220 Last EDR Contact: 08/01/2011 Next Scheduled EDR Contact: 11/14/2011 Data Release Frequency: No Update Planned SLIC REG 2: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 09/30/2004 Date Data Arrived at EDR: 10/20/2004 Date Made Active in Reports: 11/19/2004 Number of Days to Update: 30 Source: Regional Water Quality Control Board San Francisco Bay Region (2) Telephone: 510-286-0457 Last EDR Contact: 09/19/2011 Next Scheduled EDR Contact: 01/02/2012 Data Release Frequency: Quarterly SLIC REG 3: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 05/18/2006 Date Data Arrived at EDR: 05/18/2006 Date Made Active in Reports: 06/15/2006 Number of Days to Update: 28 Source: California Regional Water Quality Control Board Central Coast Region (3) Telephone: 805-549-3147 Last EDR Contact: 07/18/2011 Next Scheduled EDR Contact: 10/31/2011 Data Release Frequency: Semi-Annually SLIC REG 4: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 11/17/2004 Date Data Arrived at EDR: 11/18/2004 Date Made Active in Reports: 01/04/2005 Number of Days to Update: 47 Source: Region Water Quality Control Board Los Angeles Region (4) Telephone: 213-576-6600 Last EDR Contact: 07/01/2011 Next Scheduled EDR Contact: 10/17/2011 Data Release Frequency: Varies SLIC REG 5: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 04/01/2005 Date Data Arrived at EDR: 04/05/2005 Date Made Active in Reports: 04/21/2005 Number of Days to Update: 16 Source: Regional Water Quality Control Board Central Valley Region (5) Telephone: 916-464-3291 Last EDR Contact: 09/12/2011 Next Scheduled EDR Contact: 12/26/2011 Data Release Frequency: Semi-Annually TC5646263.2s Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING SLIC REG 6V: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 05/24/2005 Date Data Arrived at EDR: 05/25/2005 Date Made Active in Reports: 06/16/2005 Number of Days to Update: 22 Source: Regional Water Quality Control Board, Victorville Branch Telephone: 619-241-6583 Last EDR Contact: 08/15/2011 Next Scheduled EDR Contact: 11/28/2011 Data Release Frequency: Semi-Annually SLIC REG 6L: SLIC Sites The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 09/07/2004 Date Data Arrived at EDR: 09/07/2004 Date Made Active in Reports: 10/12/2004 Number of Days to Update: 35 Source: California Regional Water Quality Control Board, Lahontan Region Telephone: 530-542-5574 Last EDR Contact: 08/15/2011 Next Scheduled EDR Contact: 11/28/2011 Data Release Frequency: No Update Planned SLIC REG 7: SLIC List The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 11/24/2004 Date Data Arrived at EDR: 11/29/2004 Date Made Active in Reports: 01/04/2005 Number of Days to Update: 36 Source: California Regional Quality Control Board, Colorado River Basin Region Telephone: 760-346-7491 Last EDR Contact: 08/01/2011 Next Scheduled EDR Contact: 11/14/2011 Data Release Frequency: No Update Planned SLIC REG 8: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 04/03/2008 Date Data Arrived at EDR: 04/03/2008 Date Made Active in Reports: 04/14/2008 Number of Days to Update: 11 Source: California Region Water Quality Control Board Santa Ana Region (8) Telephone: 951-782-3298 Last EDR Contact: 09/12/2011 Next Scheduled EDR Contact: 12/26/2011 Data Release Frequency: Semi-Annually SLIC REG 9: Spills, Leaks, Investigation & Cleanup Cost Recovery Listing The SLIC (Spills, Leaks, Investigations and Cleanup) program is designed to protect and restore water quality from spills, leaks, and similar discharges. Date of Government Version: 09/10/2007 Date Data Arrived at EDR: 09/11/2007 Date Made Active in Reports: 09/28/2007 Number of Days to Update: 17 Source: California Regional Water Quality Control Board San Diego Region (9) Telephone: 858-467-2980 Last EDR Contact: 08/08/2011 Next Scheduled EDR Contact: 11/21/2011 Data Release Frequency: Annually State and tribal registered storage tank lists FEMA UST: Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks. Date of Government Version: 05/15/2017 Date Data Arrived at EDR: 05/30/2017 Date Made Active in Reports: 10/13/2017 Number of Days to Update: 136 Source: FEMA Telephone: 202-646-5797 Last EDR Contact: 04/25/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Varies TC5646263.2s Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING UST: Active UST Facilities Active UST facilities gathered from the local regulatory agencies Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: SWRCB Telephone: 916-341-5851 Last EDR Contact: 12/11/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Semi-Annually UST CLOSURE: Proposed Closure of Underground Storage Tank (UST) Cases UST cases that are being considered for closure by either the State Water Resources Control Board or the Executive Director have been posted for a 60-day public comment period. UST Case Closures being proposed for consideration by the State Water Resources Control Board. These are primarily UST cases that meet closure criteria under the decisional framework in State Water Board Resolution No. 92-49 and other Board orders. UST Case Closures proposed for consideration by the Executive Director pursuant to State Water Board Resolution No. 2012-0061. These are cases that meet the criteria of the Low-Threat UST Case Closure Policy. UST Case Closure Review Denials and Approved Orders. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/03/2019 Number of Days to Update: 21 Source: State Water Resources Control Board Telephone: 916-327-7844 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Varies MILITARY UST SITES: Military UST Sites (GEOTRACKER) Military ust sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies AST: Aboveground Petroleum Storage Tank Facilities A listing of aboveground storage tank petroleum storage tank locations. Date of Government Version: 07/06/2016 Date Data Arrived at EDR: 07/12/2016 Date Made Active in Reports: 09/19/2016 Number of Days to Update: 69 Source: California Environmental Protection Agency Telephone: 916-327-5092 Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Quarterly INDIAN UST R4: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee and Tribal Nations) Date of Government Version: 09/24/2018 Date Data Arrived at EDR: 03/12/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 50 Source: EPA Region 4 Telephone: 404-562-9424 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R5: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations). Date of Government Version: 10/12/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 5 Telephone: 312-886-6136 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies TC5646263.2s Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING INDIAN UST R10: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations). Date of Government Version: 10/17/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R7: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations). Date of Government Version: 11/07/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R8: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations). Date of Government Version: 10/16/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 8 Telephone: 303-312-6137 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R9: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations). Date of Government Version: 10/10/2018 Date Data Arrived at EDR: 03/08/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 54 Source: EPA Region 9 Telephone: 415-972-3368 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R1: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal Nations). Date of Government Version: 10/03/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA, Region 1 Telephone: 617-918-1313 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INDIAN UST R6: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes). Date of Government Version: 11/01/2018 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 55 Source: EPA Region 6 Telephone: 214-665-7591 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies TC5646263.2s Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING State and tribal voluntary cleanup sites INDIAN VCP R7: Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7. Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008 Date Made Active in Reports: 05/19/2008 Number of Days to Update: 27 Source: EPA, Region 7 Telephone: 913-551-7365 Last EDR Contact: 04/20/2009 Next Scheduled EDR Contact: 07/20/2009 Data Release Frequency: Varies INDIAN VCP R1: Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1. Date of Government Version: 07/27/2015 Date Data Arrived at EDR: 09/29/2015 Date Made Active in Reports: 02/18/2016 Number of Days to Update: 142 Source: EPA, Region 1 Telephone: 617-918-1102 Last EDR Contact: 03/25/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Varies VCP: Voluntary Cleanup Program Properties Contains low threat level properties with either confirmed or unconfirmed releases and the project proponents have request that DTSC oversee investigation and/or cleanup activities and have agreed to provide coverage for DTSC’s costs. Date of Government Version: 01/28/2019 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 35 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 04/30/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly State and tribal Brownfields sites BROWNFIELDS: Considered Brownfieds Sites Listing A listing of sites the SWRCB considers to be Brownfields since these are sites have come to them through the MOA Process. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/26/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 34 Source: State Water Resources Control Board Telephone: 916-323-7905 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS: A Listing of Brownfields Sites Brownfields are real property, the expansion, redevelopment, or reuse of which may be complicated by the presence or potential presence of a hazardous substance, pollutant, or contaminant. Cleaning up and reinvesting in these properties takes development pressures off of undeveloped, open land, and both improves and protects the environment. Assessment, Cleanup and Redevelopment Exchange System (ACRES) stores information reported by EPA Brownfields grant recipients on brownfields properties assessed or cleaned up with grant funding as well as information on Targeted Brownfields Assessments performed by EPA Regions. A listing of ACRES Brownfield sites is obtained from Cleanups in My Community. Cleanups in My Community provides information on Brownfields properties for which information is reported back to EPA, as well as areas served by Brownfields grant programs. Date of Government Version: 12/17/2018 Date Data Arrived at EDR: 12/18/2018 Date Made Active in Reports: 01/11/2019 Number of Days to Update: 24 Source: Environmental Protection Agency Telephone: 202-566-2777 Last EDR Contact: 03/19/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Semi-Annually TC5646263.2s Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Local Lists of Landfill / Solid Waste Disposal Sites WMUDS/SWAT: Waste Management Unit Database Waste Management Unit Database System. WMUDS is used by the State Water Resources Control Board staff and the Regional Water Quality Control Boards for program tracking and inventory of waste management units. WMUDS is composed of the following databases: Facility Information, Scheduled Inspections Information, Waste Management Unit Information, SWAT Program Information, SWAT Report Summary Information, SWAT Report Summary Data, Chapter 15 (formerly Subchapter 15) Information, Chapter 15 Monitoring Parameters, TPCA Program Information, RCRA Program Information, Closure Information, and Interested Parties Information. Date of Government Version: 04/01/2000 Date Data Arrived at EDR: 04/10/2000 Date Made Active in Reports: 05/10/2000 Number of Days to Update: 30 Source: State Water Resources Control Board Telephone: 916-227-4448 Last EDR Contact: 04/25/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: No Update Planned SWRCY: Recycler Database A listing of recycling facilities in California. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 48 Source: Department of Conservation Telephone: 916-323-3836 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Quarterly HAULERS: Registered Waste Tire Haulers Listing A listing of registered waste tire haulers. Date of Government Version: 03/26/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 34 Source: Integrated Waste Management Board Telephone: 916-341-6422 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Varies INDIAN ODI: Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land. Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007 Date Made Active in Reports: 01/24/2008 Number of Days to Update: 52 Source: Environmental Protection Agency Telephone: 703-308-8245 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies DEBRIS REGION 9: Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside County and northern Imperial County, California. Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009 Date Made Active in Reports: 09/21/2009 Number of Days to Update: 137 Source: EPA, Region 9 Telephone: 415-947-4219 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: No Update Planned ODI: Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258 Subtitle D Criteria. Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004 Date Made Active in Reports: 09/17/2004 Number of Days to Update: 39 Source: Environmental Protection Agency Telephone: 800-424-9346 Last EDR Contact: 06/09/2004 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned TC5646263.2s Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING IHS OPEN DUMPS: Open Dumps on Indian Land A listing of all open dumps located on Indian Land in the United States. Date of Government Version: 04/01/2014 Date Data Arrived at EDR: 08/06/2014 Date Made Active in Reports: 01/29/2015 Number of Days to Update: 176 Source: Department of Health & Human Serivces, Indian Health Service Telephone: 301-443-1452 Last EDR Contact: 04/23/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites US HIST CDL: National Clandestine Laboratory Register A listing of clandestine drug lab locations that have been removed from the DEAs National Clandestine Laboratory Register. Date of Government Version: 02/24/2019 Date Data Arrived at EDR: 02/26/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 50 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: No Update Planned HIST CAL-SITES: Calsites Database The Calsites database contains potential or confirmed hazardous substance release properties. In 1996, California EPA reevaluated and significantly reduced the number of sites in the Calsites database. No longer updated by the state agency. It has been replaced by ENVIROSTOR. Date of Government Version: 08/08/2005 Date Data Arrived at EDR: 08/03/2006 Date Made Active in Reports: 08/24/2006 Number of Days to Update: 21 Source: Department of Toxic Substance Control Telephone: 916-323-3400 Last EDR Contact: 02/23/2009 Next Scheduled EDR Contact: 05/25/2009 Data Release Frequency: No Update Planned SCH: School Property Evaluation Program This category contains proposed and existing school sites that are being evaluated by DTSC for possible hazardous materials contamination. In some cases, these properties may be listed in the CalSites category depending on the level of threat to public health and safety or the environment they pose. Date of Government Version: 01/28/2019 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 35 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 04/30/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly CDL: Clandestine Drug Labs A listing of drug lab locations. Listing of a location in this database does not indicate that any illegal drug lab materials were or were not present there, and does not constitute a determination that the location either requires or does not require additional cleanup work. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 06/12/2018 Date Made Active in Reports: 08/06/2018 Number of Days to Update: 55 Source: Department of Toxic Substances Control Telephone: 916-255-6504 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Varies TOXIC PITS: Toxic Pits Cleanup Act Sites Toxic PITS Cleanup Act Sites. TOXIC PITS identifies sites suspected of containing hazardous substances where cleanup has not yet been completed. Date of Government Version: 07/01/1995 Date Data Arrived at EDR: 08/30/1995 Date Made Active in Reports: 09/26/1995 Number of Days to Update: 27 Source: State Water Resources Control Board Telephone: 916-227-4364 Last EDR Contact: 01/26/2009 Next Scheduled EDR Contact: 04/27/2009 Data Release Frequency: No Update Planned TC5646263.2s Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CERS HAZ WASTE: CERS HAZ WASTE List of sites in the California Environmental Protection Agency (CalEPA) Regulated Site Portal which fall under the Hazardous Chemical Management, Hazardous Waste Onsite Treatment, Household Hazardous Waste Collection, Hazardous Waste Generator, and RCRA LQ HW Generator programs. Date of Government Version: 10/22/2018 Date Data Arrived at EDR: 10/23/2018 Date Made Active in Reports: 11/30/2018 Number of Days to Update: 38 Source: CalEPA Telephone: 916-323-2514 Last EDR Contact: 04/11/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Quarterly US CDL: Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this web site as a public service. It contains addresses of some locations where law enforcement agencies reported they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites. In most cases, the source of the entries is not the Department, and the Department has not verified the entry and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example, contacting local law enforcement and local health departments. Date of Government Version: 02/24/2019 Date Data Arrived at EDR: 02/26/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 50 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Quarterly PFAS: PFAS Contamination Site Location Listing A listing of PFAS contaminated sites included in the GeoTracker database. Date of Government Version: 02/21/2019 Date Data Arrived at EDR: 02/22/2019 Date Made Active in Reports: 04/15/2019 Number of Days to Update: 52 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 03/11/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Varies Local Lists of Registered Storage Tanks SWEEPS UST: SWEEPS UST Listing Statewide Environmental Evaluation and Planning System. This underground storage tank listing was updated and maintained by a company contacted by the SWRCB in the early 1990’s. The listing is no longer updated or maintained. The local agency is the contact for more information on a site on the SWEEPS list. Date of Government Version: 06/01/1994 Date Data Arrived at EDR: 07/07/2005 Date Made Active in Reports: 08/11/2005 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: N/A Last EDR Contact: 06/03/2005 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned UST MENDOCINO: Mendocino County UST Database A listing of underground storage tank locations in Mendocino County. Date of Government Version: 12/04/2018 Date Data Arrived at EDR: 12/06/2018 Date Made Active in Reports: 12/14/2018 Number of Days to Update: 8 Source: Department of Public Health Telephone: 707-463-4466 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Annually HIST UST: Hazardous Substance Storage Container Database The Hazardous Substance Storage Container Database is a historical listing of UST sites. Refer to local/county source for current data. TC5646263.2s Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 10/15/1990 Date Data Arrived at EDR: 01/25/1991 Date Made Active in Reports: 02/12/1991 Number of Days to Update: 18 Source: State Water Resources Control Board Telephone: 916-341-5851 Last EDR Contact: 07/26/2001 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned SAN FRANCISCO AST: Aboveground Storage Tank Site Listing Aboveground storage tank sites Date of Government Version: 09/11/2018 Date Data Arrived at EDR: 09/12/2018 Date Made Active in Reports: 10/11/2018 Number of Days to Update: 29 Source: San Francisco County Department of Public Health Telephone: 415-252-3896 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies CA FID UST: Facility Inventory Database The Facility Inventory Database (FID) contains a historical listing of active and inactive underground storage tank locations from the State Water Resource Control Board. Refer to local/county source for current data. Date of Government Version: 10/31/1994 Date Data Arrived at EDR: 09/05/1995 Date Made Active in Reports: 09/29/1995 Number of Days to Update: 24 Source: California Environmental Protection Agency Telephone: 916-341-5851 Last EDR Contact: 12/28/1998 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned CERS TANKS: California Environmental Reporting System (CERS) Tanks List of sites in the California Environmental Protection Agency (CalEPA) Regulated Site Portal which fall under the Aboveground Petroleum Storage and Underground Storage Tank regulatory programs. Date of Government Version: 10/22/2018 Date Data Arrived at EDR: 10/23/2018 Date Made Active in Reports: 11/30/2018 Number of Days to Update: 38 Source: California Environmental Protection Agency Telephone: 916-323-2514 Last EDR Contact: 04/11/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Quarterly Local Land Records LIENS: Environmental Liens Listing A listing of property locations with environmental liens for California where DTSC is a lien holder. Date of Government Version: 02/28/2019 Date Data Arrived at EDR: 03/01/2019 Date Made Active in Reports: 04/02/2019 Number of Days to Update: 32 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies LIENS 2: CERCLA Lien Information A Federal CERCLA (’Superfund’) lien can exist by operation of law at any site or property at which EPA has spent Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination. CERCLIS provides information as to the identity of these sites and properties. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 7 Source: Environmental Protection Agency Telephone: 202-564-6023 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Semi-Annually DEED: Deed Restriction Listing TC5646263.2s Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Site Mitigation and Brownfields Reuse Program Facility Sites with Deed Restrictions & Hazardous Waste Management Program Facility Sites with Deed / Land Use Restriction. The DTSC Site Mitigation and Brownfields Reuse Program (SMBRP) list includes sites cleaned up under the program’s oversight and generally does not include current or former hazardous waste facilities that required a hazardous waste facility permit. The list represents deed restrictions that are active. Some sites have multiple deed restrictions. The DTSC Hazardous Waste Management Program (HWMP) has developed a list of current or former hazardous waste facilities that have a recorded land use restriction at the local county recorder’s office. The land use restrictions on this list were required by the DTSC HWMP as a result of the presence of hazardous substances that remain on site after the facility (or part of the facility) has been closed or cleaned up. The types of land use restriction include deed notice, deed restriction, or a land use restriction that binds current and future owners. Date of Government Version: 03/04/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 27 Source: DTSC and SWRCB Telephone: 916-323-3400 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Semi-Annually Records of Emergency Release Reports HMIRS: Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT. Date of Government Version: 02/08/2019 Date Data Arrived at EDR: 02/08/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 41 Source: U.S. Department of Transportation Telephone: 202-366-4555 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly CHMIRS: California Hazardous Material Incident Report System California Hazardous Material Incident Reporting System. CHMIRS contains information on reported hazardous material incidents (accidental releases or spills). Date of Government Version: 10/24/2018 Date Data Arrived at EDR: 01/24/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 40 Source: Office of Emergency Services Telephone: 916-845-8400 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Semi-Annually LDS: Land Disposal Sites Listing (GEOTRACKER) Land Disposal sites (Landfills) included in GeoTracker. GeoTracker is the Water Boards data management system for sites that impact, or have the potential to impact, water quality in California, with emphasis on groundwater. Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Qualilty Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Quarterly MCS: Military Cleanup Sites Listing (GEOTRACKER) Military sites (consisting of: Military UST sites; Military Privatized sites; and Military Cleanup sites [formerly known as DoD non UST]) included in GeoTracker. GeoTracker is the Water Boards data management system for sites that impact, or have the potential to impact, water quality in California, with emphasis on groundwater. Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Quarterly TC5646263.2s Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING SPILLS 90: SPILLS90 data from FirstSearch Spills 90 includes those spill and release records available exclusively from FirstSearch databases. Typically, they may include chemical, oil and/or hazardous substance spills recorded after 1990. Duplicate records that are already included in EDR incident and release records are not included in Spills 90. Date of Government Version: 06/06/2012 Date Data Arrived at EDR: 01/03/2013 Date Made Active in Reports: 02/22/2013 Number of Days to Update: 50 Source: FirstSearch Telephone: N/A Last EDR Contact: 01/03/2013 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned Other Ascertainable Records RCRA NonGen / NLR: RCRA - Non Generators / No Longer Regulated RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous waste. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/27/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 21 Source: Environmental Protection Agency Telephone: (415) 495-8895 Last EDR Contact: 03/27/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly FUDS: Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers is actively working or will take necessary cleanup actions. Date of Government Version: 01/31/2015 Date Data Arrived at EDR: 07/08/2015 Date Made Active in Reports: 10/13/2015 Number of Days to Update: 97 Source: U.S. Army Corps of Engineers Telephone: 202-528-4285 Last EDR Contact: 04/03/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies DOD: Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 62 Source: USGS Telephone: 888-275-8747 Last EDR Contact: 04/12/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Semi-Annually FEDLAND: Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land, Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management, Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 339 Source: U.S. Geological Survey Telephone: 888-275-8747 Last EDR Contact: 04/12/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: N/A SCRD DRYCLEANERS: State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas, Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin. TC5646263.2s Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 01/01/2017 Date Data Arrived at EDR: 02/03/2017 Date Made Active in Reports: 04/07/2017 Number of Days to Update: 63 Source: Environmental Protection Agency Telephone: 615-532-8599 Last EDR Contact: 02/15/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Varies US FIN ASSUR: Financial Assurance Information All owners and operators of facilities that treat, store, or dispose of hazardous waste are required to provide proof that they will have sufficient funds to pay for the clean up, closure, and post-closure care of their facilities. Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/26/2019 Date Made Active in Reports: 05/07/2019 Number of Days to Update: 42 Source: Environmental Protection Agency Telephone: 202-566-1917 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly EPA WATCH LIST: EPA WATCH LIST EPA maintains a "Watch List" to facilitate dialogue between EPA, state and local environmental agencies on enforcement matters relating to facilities with alleged violations identified as either significant or high priority. Being on the Watch List does not mean that the facility has actually violated the law only that an investigation by EPA or a state or local environmental agency has led those organizations to allege that an unproven violation has in fact occurred. Being on the Watch List does not represent a higher level of concern regarding the alleged violations that were detected, but instead indicates cases requiring additional dialogue between EPA, state and local agencies - primarily because of the length of time the alleged violation has gone unaddressed or unresolved. Date of Government Version: 08/30/2013 Date Data Arrived at EDR: 03/21/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 88 Source: Environmental Protection Agency Telephone: 617-520-3000 Last EDR Contact: 05/06/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly 2020 COR ACTION: 2020 Corrective Action Program List The EPA has set ambitious goals for the RCRA Corrective Action program by creating the 2020 Corrective Action Universe. This RCRA cleanup baseline includes facilities expected to need corrective action. The 2020 universe contains a wide variety of sites. Some properties are heavily contaminated while others were contaminated but have since been cleaned up. Still others have not been fully investigated yet, and may require little or no remediation. Inclusion in the 2020 Universe does not necessarily imply failure on the part of a facility to meet its RCRA obligations. Date of Government Version: 09/30/2017 Date Data Arrived at EDR: 05/08/2018 Date Made Active in Reports: 07/20/2018 Number of Days to Update: 73 Source: Environmental Protection Agency Telephone: 703-308-4044 Last EDR Contact: 02/08/2019 Next Scheduled EDR Contact: 05/20/2019 Data Release Frequency: Varies TSCA: Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant site. Date of Government Version: 12/31/2016 Date Data Arrived at EDR: 06/21/2017 Date Made Active in Reports: 01/05/2018 Number of Days to Update: 198 Source: EPA Telephone: 202-260-5521 Last EDR Contact: 03/22/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Every 4 Years TRIS: Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and land in reportable quantities under SARA Title III Section 313. TC5646263.2s Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 12/31/2016 Date Data Arrived at EDR: 01/10/2018 Date Made Active in Reports: 01/12/2018 Number of Days to Update: 2 Source: EPA Telephone: 202-566-0250 Last EDR Contact: 02/20/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Annually SSTS: Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March 1st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices being produced, and those having been produced and sold or distributed in the past year. Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010 Date Made Active in Reports: 02/25/2011 Number of Days to Update: 77 Source: EPA Telephone: 202-564-4203 Last EDR Contact: 04/24/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Annually ROD: Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical and health information to aid in the cleanup. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 18 Source: EPA Telephone: 703-416-0223 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Annually RMP: Risk Management Plans When Congress passed the Clean Air Act Amendments of 1990, it required EPA to publish regulations and guidance for chemical accident prevention at facilities using extremely hazardous substances. The Risk Management Program Rule (RMP Rule) was written to implement Section 112(r) of these amendments. The rule, which built upon existing industry codes and standards, requires companies of all sizes that use certain flammable and toxic substances to develop a Risk Management Program, which includes a(n): Hazard assessment that details the potential effects of an accidental release, an accident history of the last five years, and an evaluation of worst-case and alternative accidental releases; Prevention program that includes safety precautions and maintenance, monitoring, and employee training measures; and Emergency response program that spells out emergency health care, employee training measures and procedures for informing the public and response agencies (e.g the fire department) should an accident occur. Date of Government Version: 02/01/2019 Date Data Arrived at EDR: 02/14/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 35 Source: Environmental Protection Agency Telephone: 202-564-8600 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies RAATS: RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources made it impossible to continue to update the information contained in the database. Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995 Date Made Active in Reports: 08/07/1995 Number of Days to Update: 35 Source: EPA Telephone: 202-564-4104 Last EDR Contact: 06/02/2008 Next Scheduled EDR Contact: 09/01/2008 Data Release Frequency: No Update Planned TC5646263.2s Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING PRP: Potentially Responsible Parties A listing of verified Potentially Responsible Parties Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 04/17/2019 Number of Days to Update: 34 Source: EPA Telephone: 202-564-6023 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 05/20/2019 Data Release Frequency: Quarterly PADS: PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers of PCB’s who are required to notify the EPA of such activities. Date of Government Version: 09/14/2018 Date Data Arrived at EDR: 10/11/2018 Date Made Active in Reports: 12/07/2018 Number of Days to Update: 57 Source: EPA Telephone: 202-566-0500 Last EDR Contact: 04/10/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Annually ICIS: Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES) program. Date of Government Version: 11/18/2016 Date Data Arrived at EDR: 11/23/2016 Date Made Active in Reports: 02/10/2017 Number of Days to Update: 79 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR Contact: 04/08/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Quarterly FTTS: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act) FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA, TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the Agency on a quarterly basis. Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA/Office of Prevention, Pesticides and Toxic Substances Telephone: 202-566-1667 Last EDR Contact: 08/18/2017 Next Scheduled EDR Contact: 12/04/2017 Data Release Frequency: Quarterly FTTS INSP: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act) A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements. Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA Telephone: 202-566-1667 Last EDR Contact: 08/18/2017 Next Scheduled EDR Contact: 12/04/2017 Data Release Frequency: Quarterly MLTS: Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency, EDR contacts the Agency on a quarterly basis. Date of Government Version: 08/30/2016 Date Data Arrived at EDR: 09/08/2016 Date Made Active in Reports: 10/21/2016 Number of Days to Update: 43 Source: Nuclear Regulatory Commission Telephone: 301-415-7169 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Quarterly TC5646263.2s Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING COAL ASH DOE: Steam-Electric Plant Operation Data A listing of power plants that store ash in surface ponds. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009 Date Made Active in Reports: 10/22/2009 Number of Days to Update: 76 Source: Department of Energy Telephone: 202-586-8719 Last EDR Contact: 03/07/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies COAL ASH EPA: Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings. Date of Government Version: 07/01/2014 Date Data Arrived at EDR: 09/10/2014 Date Made Active in Reports: 10/20/2014 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: N/A Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies PCB TRANSFORMER: PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals. Date of Government Version: 05/24/2017 Date Data Arrived at EDR: 11/30/2017 Date Made Active in Reports: 12/15/2017 Number of Days to Update: 15 Source: Environmental Protection Agency Telephone: 202-566-0517 Last EDR Contact: 04/26/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies RADINFO: Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S. Environmental Protection Agency (EPA) regulations for radiation and radioactivity. Date of Government Version: 01/02/2019 Date Data Arrived at EDR: 01/03/2019 Date Made Active in Reports: 03/15/2019 Number of Days to Update: 71 Source: Environmental Protection Agency Telephone: 202-343-9775 Last EDR Contact: 04/02/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly HIST FTTS: FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated. Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR Contact: 12/17/2007 Next Scheduled EDR Contact: 03/17/2008 Data Release Frequency: No Update Planned HIST FTTS INSP: FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated. TC5646263.2s Page GR-23 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR Contact: 12/17/2008 Next Scheduled EDR Contact: 03/17/2008 Data Release Frequency: No Update Planned DOT OPS: Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data. Date of Government Version: 12/03/2018 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 51 Source: Department of Transporation, Office of Pipeline Safety Telephone: 202-366-4595 Last EDR Contact: 04/30/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly CONSENT: Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released periodically by United States District Courts after settlement by parties to litigation matters. Date of Government Version: 12/31/2018 Date Data Arrived at EDR: 02/11/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 38 Source: Department of Justice, Consent Decree Library Telephone: Varies Last EDR Contact: 04/05/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Varies BRS: Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG) and Treatment, Storage, and Disposal Facilities. Date of Government Version: 12/31/2015 Date Data Arrived at EDR: 02/22/2017 Date Made Active in Reports: 09/28/2017 Number of Days to Update: 218 Source: EPA/NTIS Telephone: 800-424-9346 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Biennially INDIAN RESERV: Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater than 640 acres. Date of Government Version: 12/31/2014 Date Data Arrived at EDR: 07/14/2015 Date Made Active in Reports: 01/10/2017 Number of Days to Update: 546 Source: USGS Telephone: 202-208-3710 Last EDR Contact: 04/11/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Semi-Annually FUSRAP: Formerly Utilized Sites Remedial Action Program DOE established the Formerly Utilized Sites Remedial Action Program (FUSRAP) in 1974 to remediate sites where radioactive contamination remained from Manhattan Project and early U.S. Atomic Energy Commission (AEC) operations. Date of Government Version: 08/08/2017 Date Data Arrived at EDR: 09/11/2018 Date Made Active in Reports: 09/14/2018 Number of Days to Update: 3 Source: Department of Energy Telephone: 202-586-3559 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies UMTRA: Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings were used as construction materials before the potential health hazards of the tailings were recognized. TC5646263.2s Page GR-24 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 06/23/2017 Date Data Arrived at EDR: 10/11/2017 Date Made Active in Reports: 11/03/2017 Number of Days to Update: 23 Source: Department of Energy Telephone: 505-845-0011 Last EDR Contact: 02/22/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies LEAD SMELTER 1: Lead Smelter Sites A listing of former lead smelter site locations. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/14/2019 Date Made Active in Reports: 03/21/2019 Number of Days to Update: 7 Source: Environmental Protection Agency Telephone: 703-603-8787 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Varies LEAD SMELTER 2: Lead Smelter Sites A list of several hundred sites in the U.S. where secondary lead smelting was done from 1931and 1964. These sites may pose a threat to public health through ingestion or inhalation of contaminated soil or dust Date of Government Version: 04/05/2001 Date Data Arrived at EDR: 10/27/2010 Date Made Active in Reports: 12/02/2010 Number of Days to Update: 36 Source: American Journal of Public Health Telephone: 703-305-6451 Last EDR Contact: 12/02/2009 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned US AIRS (AFS): Aerometric Information Retrieval System Facility Subsystem (AFS) The database is a sub-system of Aerometric Information Retrieval System (AIRS). AFS contains compliance data on air pollution point sources regulated by the U.S. EPA and/or state and local air regulatory agencies. This information comes from source reports by various stationary sources of air pollution, such as electric power plants, steel mills, factories, and universities, and provides information about the air pollutants they produce. Action, air program, air program pollutant, and general level plant data. It is used to track emissions and compliance data from industrial plants. Date of Government Version: 10/12/2016 Date Data Arrived at EDR: 10/26/2016 Date Made Active in Reports: 02/03/2017 Number of Days to Update: 100 Source: EPA Telephone: 202-564-2496 Last EDR Contact: 09/26/2017 Next Scheduled EDR Contact: 01/08/2018 Data Release Frequency: Annually US AIRS MINOR: Air Facility System Data A listing of minor source facilities. Date of Government Version: 10/12/2016 Date Data Arrived at EDR: 10/26/2016 Date Made Active in Reports: 02/03/2017 Number of Days to Update: 100 Source: EPA Telephone: 202-564-2496 Last EDR Contact: 09/26/2017 Next Scheduled EDR Contact: 01/08/2018 Data Release Frequency: Annually US MINES: Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes violation information. Date of Government Version: 11/27/2018 Date Data Arrived at EDR: 02/27/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 33 Source: Department of Labor, Mine Safety and Health Administration Telephone: 303-231-5959 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Semi-Annually US MINES 2: Ferrous and Nonferrous Metal Mines Database Listing This map layer includes ferrous (ferrous metal mines are facilities that extract ferrous metals, such as iron ore or molybdenum) and nonferrous (Nonferrous metal mines are facilities that extract nonferrous metals, such as gold, silver, copper, zinc, and lead) metal mines in the United States. TC5646263.2s Page GR-25 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 12/05/2005 Date Data Arrived at EDR: 02/29/2008 Date Made Active in Reports: 04/18/2008 Number of Days to Update: 49 Source: USGS Telephone: 703-648-7709 Last EDR Contact: 03/01/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies US MINES 3: Active Mines & Mineral Plants Database Listing Active Mines and Mineral Processing Plant operations for commodities monitored by the Minerals Information Team of the USGS. Date of Government Version: 04/14/2011 Date Data Arrived at EDR: 06/08/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 97 Source: USGS Telephone: 703-648-7709 Last EDR Contact: 03/01/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies ABANDONED MINES: Abandoned Mines An inventory of land and water impacted by past mining (primarily coal mining) is maintained by OSMRE to provide information needed to implement the Surface Mining Control and Reclamation Act of 1977 (SMCRA). The inventory contains information on the location, type, and extent of AML impacts, as well as, information on the cost associated with the reclamation of those problems. The inventory is based upon field surveys by State, Tribal, and OSMRE program officials. It is dynamic to the extent that it is modified as new problems are identified and existing problems are reclaimed. Date of Government Version: 03/27/2019 Date Data Arrived at EDR: 03/28/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 34 Source: Department of Interior Telephone: 202-208-2609 Last EDR Contact: 03/21/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Quarterly FINDS: Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and ’pointers’ to other sources that contain more detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System). Date of Government Version: 02/15/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 03/15/2019 Number of Days to Update: 10 Source: EPA Telephone: (415) 947-8000 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Quarterly DOCKET HWC: Hazardous Waste Compliance Docket Listing A complete list of the Federal Agency Hazardous Waste Compliance Docket Facilities. Date of Government Version: 05/31/2018 Date Data Arrived at EDR: 07/26/2018 Date Made Active in Reports: 10/05/2018 Number of Days to Update: 71 Source: Environmental Protection Agency Telephone: 202-564-0527 Last EDR Contact: 03/01/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies UXO: Unexploded Ordnance Sites A listing of unexploded ordnance site locations Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 01/17/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 74 Source: Department of Defense Telephone: 703-704-1564 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Varies TC5646263.2s Page GR-26 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING ECHO: Enforcement & Compliance History Information ECHO provides integrated compliance and enforcement information for about 800,000 regulated facilities nationwide. Date of Government Version: 03/03/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: 202-564-2280 Last EDR Contact: 04/09/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Quarterly FUELS PROGRAM: EPA Fuels Program Registered Listing This listing includes facilities that are registered under the Part 80 (Code of Federal Regulations) EPA Fuels Programs. All companies now are required to submit new and updated registrations. Date of Government Version: 02/19/2019 Date Data Arrived at EDR: 02/21/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 39 Source: EPA Telephone: 800-385-6164 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Quarterly CA BOND EXP. PLAN: Bond Expenditure Plan Department of Health Services developed a site-specific expenditure plan as the basis for an appropriation of Hazardous Substance Cleanup Bond Act funds. It is not updated. Date of Government Version: 01/01/1989 Date Data Arrived at EDR: 07/27/1994 Date Made Active in Reports: 08/02/1994 Number of Days to Update: 6 Source: Department of Health Services Telephone: 916-255-2118 Last EDR Contact: 05/31/1994 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned CORTESE: "Cortese" Hazardous Waste & Substances Sites List The sites for the list are designated by the State Water Resource Control Board (LUST), the Integrated Waste Board (SWF/LS), and the Department of Toxic Substances Control (Cal-Sites). Date of Government Version: 03/25/2019 Date Data Arrived at EDR: 03/26/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 36 Source: CAL EPA/Office of Emergency Information Telephone: 916-323-3400 Last EDR Contact: 03/26/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly CUPA SAN FRANCISCO CO: CUPA Facility Listing Cupa facilities Date of Government Version: 04/18/2019 Date Data Arrived at EDR: 04/19/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 11 Source: San Francisco County Department of Environmental Health Telephone: 415-252-3896 Last EDR Contact: 04/18/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies CUPA LIVERMORE-PLEASANTON: CUPA Facility Listing list of facilities associated with the various CUPA programs in Livermore-Pleasanton Date of Government Version: 01/23/2019 Date Data Arrived at EDR: 02/26/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 34 Source: Livermore-Pleasanton Fire Department Telephone: 925-454-2361 Last EDR Contact: 02/26/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Varies DRYCLEAN AVAQMD: Antelope Valley Air Quality Management District Drycleaner Listing A listing of dry cleaners in the Antelope Valley Air Quality Management District. TC5646263.2s Page GR-27 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 02/27/2019 Date Data Arrived at EDR: 02/28/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 32 Source: Antelope Valley Air Quality Management District Telephone: 661-723-8070 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies DRYCLEANERS: Cleaner Facilities A list of drycleaner related facilities that have EPA ID numbers. These are facilities with certain SIC codes: power laundries, family and commercial; garment pressing and cleaner’s agents; linen supply; coin-operated laundries and cleaning; drycleaning plants, except rugs; carpet and upholster cleaning; industrial launderers; laundry and garment services. Date of Government Version: 12/13/2018 Date Data Arrived at EDR: 01/17/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 47 Source: Department of Toxic Substance Control Telephone: 916-327-4498 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Annually DRYCLEAN SOUTH COAST: South Coast Air Quality Management District Drycleaner Listing A listing of dry cleaners in the South Coast Air Quality Management District Date of Government Version: 03/19/2019 Date Data Arrived at EDR: 03/22/2019 Date Made Active in Reports: 04/09/2019 Number of Days to Update: 18 Source: South Coast Air Quality Management District Telephone: 909-396-3211 Last EDR Contact: 03/22/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies EMI: Emissions Inventory Data Toxics and criteria pollutant emissions data collected by the ARB and local air pollution agencies. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 06/20/2018 Date Made Active in Reports: 08/06/2018 Number of Days to Update: 47 Source: California Air Resources Board Telephone: 916-322-2990 Last EDR Contact: 03/22/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Varies ENF: Enforcement Action Listing A listing of Water Board Enforcement Actions. Formal is everything except Oral/Verbal Communication, Notice of Violation, Expedited Payment Letter, and Staff Enforcement Letter. Date of Government Version: 11/01/2018 Date Data Arrived at EDR: 11/02/2018 Date Made Active in Reports: 12/13/2018 Number of Days to Update: 41 Source: State Water Resoruces Control Board Telephone: 916-445-9379 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies Financial Assurance 1: Financial Assurance Information Listing Financial Assurance information Date of Government Version: 01/10/2019 Date Data Arrived at EDR: 01/23/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 41 Source: Department of Toxic Substances Control Telephone: 916-255-3628 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies Financial Assurance 2: Financial Assurance Information Listing A listing of financial assurance information for solid waste facilities. Financial assurance is intended to ensure that resources are available to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated facility is unable or unwilling to pay. TC5646263.2s Page GR-28 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 02/15/2019 Date Data Arrived at EDR: 02/19/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 14 Source: California Integrated Waste Management Board Telephone: 916-341-6066 Last EDR Contact: 02/11/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Varies HAZNET: Facility and Manifest Data Facility and Manifest Data. The data is extracted from the copies of hazardous waste manifests received each year by the DTSC. The annual volume of manifests is typically 700,000 - 1,000,000 annually, representing approximately 350,000 - 500,000 shipments. Data are from the manifests submitted without correction, and therefore many contain some invalid values for data elements such as generator ID, TSD ID, waste category, and disposal method. This database begins with calendar year 1993. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 10/10/2018 Date Made Active in Reports: 11/16/2018 Number of Days to Update: 37 Source: California Environmental Protection Agency Telephone: 916-255-1136 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Annually ICE: ICE Contains data pertaining to the Permitted Facilities with Inspections / Enforcements sites tracked in Envirostor. Date of Government Version: 02/19/2019 Date Data Arrived at EDR: 02/20/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 13 Source: Department of Toxic Subsances Control Telephone: 877-786-9427 Last EDR Contact: 02/20/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Quarterly HIST CORTESE: Hazardous Waste & Substance Site List The sites for the list are designated by the State Water Resource Control Board [LUST], the Integrated Waste Board [SWF/LS], and the Department of Toxic Substances Control [CALSITES]. This listing is no longer updated by the state agency. Date of Government Version: 04/01/2001 Date Data Arrived at EDR: 01/22/2009 Date Made Active in Reports: 04/08/2009 Number of Days to Update: 76 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 01/22/2009 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned HWP: EnviroStor Permitted Facilities Listing Detailed information on permitted hazardous waste facilities and corrective action ("cleanups") tracked in EnviroStor. Date of Government Version: 02/19/2019 Date Data Arrived at EDR: 02/20/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 13 Source: Department of Toxic Substances Control Telephone: 916-323-3400 Last EDR Contact: 02/20/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Quarterly HWT: Registered Hazardous Waste Transporter Database A listing of hazardous waste transporters. In California, unless specifically exempted, it is unlawful for any person to transport hazardous wastes unless the person holds a valid registration issued by DTSC. A hazardous waste transporter registration is valid for one year and is assigned a unique registration number. Date of Government Version: 01/07/2019 Date Data Arrived at EDR: 01/08/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 56 Source: Department of Toxic Substances Control Telephone: 916-440-7145 Last EDR Contact: 04/09/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Quarterly TC5646263.2s Page GR-29 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING MINES: Mines Site Location Listing A listing of mine site locations from the Office of Mine Reclamation. Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/12/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 34 Source: Department of Conservation Telephone: 916-322-1080 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Quarterly MWMP: Medical Waste Management Program Listing The Medical Waste Management Program (MWMP) ensures the proper handling and disposal of medical waste by permitting and inspecting medical waste Offsite Treatment Facilities (PDF) and Transfer Stations (PDF) throughout the state. MWMP also oversees all Medical Waste Transporters. Date of Government Version: 02/20/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/02/2019 Number of Days to Update: 28 Source: Department of Public Health Telephone: 916-558-1784 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies NPDES: NPDES Permits Listing A listing of NPDES permits, including stormwater. Date of Government Version: 02/11/2019 Date Data Arrived at EDR: 02/12/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 23 Source: State Water Resources Control Board Telephone: 916-445-9379 Last EDR Contact: 02/12/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Quarterly PEST LIC: Pesticide Regulation Licenses Listing A listing of licenses and certificates issued by the Department of Pesticide Regulation. The DPR issues licenses and/or certificates to: Persons and businesses that apply or sell pesticides; Pest control dealers and brokers; Persons who advise on agricultural pesticide applications. Date of Government Version: 03/04/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/05/2019 Number of Days to Update: 31 Source: Department of Pesticide Regulation Telephone: 916-445-4038 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Quarterly PROC: Certified Processors Database A listing of certified processors. Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 47 Source: Department of Conservation Telephone: 916-323-3836 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Quarterly NOTIFY 65: Proposition 65 Records Listings of all Proposition 65 incidents reported to counties by the State Water Resources Control Board and the Regional Water Quality Control Board. This database is no longer updated by the reporting agency. Date of Government Version: 03/18/2019 Date Data Arrived at EDR: 03/19/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 41 Source: State Water Resources Control Board Telephone: 916-445-3846 Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: No Update Planned TC5646263.2s Page GR-30 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING UIC: UIC Listing A listing of wells identified as underground injection wells, in the California Oil and Gas Wells database. Date of Government Version: 04/27/2018 Date Data Arrived at EDR: 06/13/2018 Date Made Active in Reports: 07/17/2018 Number of Days to Update: 34 Source: Deaprtment of Conservation Telephone: 916-445-2408 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Varies UIC GEO: Underground Injection Control Sites (GEOTRACKER) Underground control injection sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resource Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies WASTEWATER PITS: Oil Wastewater Pits Listing Water officials discovered that oil producers have been dumping chemical-laden wastewater into hundreds of unlined pits that are operating without proper permits. Inspections completed by the Central Valley Regional Water Quality Control Board revealed the existence of previously unidentified waste sites. The water boards review found that more than one-third of the region’s active disposal pits are operating without permission. Date of Government Version: 05/08/2018 Date Data Arrived at EDR: 07/11/2018 Date Made Active in Reports: 09/13/2018 Number of Days to Update: 64 Source: RWQCB, Central Valley Region Telephone: 559-445-5577 Last EDR Contact: 04/12/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Varies WDS: Waste Discharge System Sites which have been issued waste discharge requirements. Date of Government Version: 06/19/2007 Date Data Arrived at EDR: 06/20/2007 Date Made Active in Reports: 06/29/2007 Number of Days to Update: 9 Source: State Water Resources Control Board Telephone: 916-341-5227 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Quarterly MILITARY PRIV SITES: Military Privatized Sites (GEOTRACKER) Military privatized sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies PROJECT: Project Sites (GEOTRACKER) Projects sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies WDR: Waste Discharge Requirements Listing In general, the Waste Discharge Requirements (WDRs) Program (sometimes also referred to as the "Non Chapter 15 (Non 15) Program") regulates point discharges that are exempt pursuant to Subsection 20090 of Title 27 and not subject to the Federal Water Pollution Control Act. Exemptions from Title 27 may be granted for nine categories of discharges (e.g., sewage, wastewater, etc.) that meet, and continue to meet, the preconditions listed for each specific exemption. The scope of the WDRs Program also includes the discharge of wastes classified as inert, pursuant to section 20230 of Title 27. TC5646263.2s Page GR-31 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 47 Source: State Water Resources Control Board Telephone: 916-341-5810 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Quarterly CIWQS: California Integrated Water Quality System The California Integrated Water Quality System (CIWQS) is a computer system used by the State and Regional Water Quality Control Boards to track information about places of environmental interest, manage permits and other orders, track inspections, and manage violations and enforcement activities. Date of Government Version: 03/05/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/02/2019 Number of Days to Update: 28 Source: State Water Resources Control Board Telephone: 866-794-4977 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies CERS: CalEPA Regulated Site Portal Data The CalEPA Regulated Site Portal database combines data about environmentally regulated sites and facilities in California into a single database. It combines data from a variety of state and federal databases, and provides an overview of regulated activities across the spectrum of environmental programs for any given location in California. These activities include hazardous materials and waste, state and federal cleanups, impacted ground and surface waters, and toxic materials Date of Government Version: 10/22/2018 Date Data Arrived at EDR: 10/23/2018 Date Made Active in Reports: 11/30/2018 Number of Days to Update: 38 Source: California Environmental Protection Agency Telephone: 916-323-2514 Last EDR Contact: 04/11/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies WIP: Well Investigation Program Case List Well Investigation Program case in the San Gabriel and San Fernando Valley area. Date of Government Version: 07/03/2009 Date Data Arrived at EDR: 07/21/2009 Date Made Active in Reports: 08/03/2009 Number of Days to Update: 13 Source: Los Angeles Water Quality Control Board Telephone: 213-576-6726 Last EDR Contact: 03/25/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Varies NON-CASE INFO: Non-Case Information Sites (GEOTRACKER) Non-Case Information sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies OTHER OIL GAS: Other Oil & Gas Projects Sites (GEOTRACKER) Other Oil & Gas Projects sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies PROD WATER PONDS: Produced Water Ponds Sites (GEOTRACKER) Produced water ponds sites TC5646263.2s Page GR-32 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies SAMPLING POINT: Sampling Point ? Public Sites (GEOTRACKER) Sampling point - public sites Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies WELL STIM PROJ: Well Stimulation Project (GEOTRACKER) Includes areas of groundwater monitoring plans, a depiction of the monitoring network, and the facilities, boundaries, and subsurface characteristics of the oilfield and the features (oil and gas wells, produced water ponds, UIC wells, water supply wells, etc?) being monitored Date of Government Version: 12/10/2018 Date Data Arrived at EDR: 12/11/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 35 Source: State Water Resources Control Board Telephone: 866-480-1028 Last EDR Contact: 12/12/2018 Next Scheduled EDR Contact: 03/25/2019 Data Release Frequency: Varies EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR MGP: EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants) compiled by EDR’s researchers. Manufactured gas sites were used in the United States from the 1800’s to 1950’s to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production, such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds are potentially hazardous to human health and the environment. The byproduct from this process was frequently disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil and groundwater contamination. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned EDR Hist Auto: EDR Exclusive Historical Auto Stations EDR has searched selected national collections of business directories and has collected listings of potential gas station/filling station/service station sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include gas station/filling station/service station establishments. The categories reviewed included, but were not limited to gas, gas station, gasoline station, filling station, auto, automobile repair, auto service station, service station, etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: Varies TC5646263.2s Page GR-33 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING EDR Hist Cleaner: EDR Exclusive Historical Cleaners EDR has searched selected national collections of business directories and has collected listings of potential dry cleaner sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include dry cleaning establishments. The categories reviewed included, but were not limited to dry cleaners, cleaners, laundry, laundromat, cleaning/laundry, wash & dry etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: Varies EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives RGA LF: Recovered Government Archive Solid Waste Facilities List The EDR Recovered Government Archive Landfill database provides a list of landfills derived from historical databases and includes many records that no longer appear in current government lists. Compiled from Records formerly available from the Department of Resources Recycling and Recovery in California. Date of Government Version: N/A Date Data Arrived at EDR: 07/01/2013 Date Made Active in Reports: 01/13/2014 Number of Days to Update: 196 Source: Department of Resources Recycling and Recovery Telephone: N/A Last EDR Contact: 06/01/2012 Next Scheduled EDR Contact: N/A Data Release Frequency: Varies RGA LUST: Recovered Government Archive Leaking Underground Storage Tank The EDR Recovered Government Archive Leaking Underground Storage Tank database provides a list of LUST incidents derived from historical databases and includes many records that no longer appear in current government lists. Compiled from Records formerly available from the State Water Resources Control Board in California. Date of Government Version: N/A Date Data Arrived at EDR: 07/01/2013 Date Made Active in Reports: 12/30/2013 Number of Days to Update: 182 Source: State Water Resources Control Board Telephone: N/A Last EDR Contact: 06/01/2012 Next Scheduled EDR Contact: N/A Data Release Frequency: Varies COUNTY RECORDS ALAMEDA COUNTY: CS ALAMEDA: Contaminated Sites A listing of contaminated sites overseen by the Toxic Release Program (oil and groundwater contamination from chemical releases and spills) and the Leaking Underground Storage Tank Program (soil and ground water contamination from leaking petroleum USTs). Date of Government Version: 01/09/2019 Date Data Arrived at EDR: 01/11/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 53 Source: Alameda County Environmental Health Services Telephone: 510-567-6700 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Semi-Annually UST ALAMEDA: Underground Tanks Underground storage tank sites located in Alameda county. Date of Government Version: 01/07/2019 Date Data Arrived at EDR: 01/08/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 59 Source: Alameda County Environmental Health Services Telephone: 510-567-6700 Last EDR Contact: 04/08/2019 Next Scheduled EDR Contact: 04/24/2047 Data Release Frequency: Semi-Annually AMADOR COUNTY: TC5646263.2s Page GR-34 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA AMADOR: CUPA Facility List Cupa Facility List Date of Government Version: 01/07/2019 Date Data Arrived at EDR: 01/08/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 58 Source: Amador County Environmental Health Telephone: 209-223-6439 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Varies BUTTE COUNTY: CUPA BUTTE: CUPA Facility Listing Cupa facility list. Date of Government Version: 04/21/2017 Date Data Arrived at EDR: 04/25/2017 Date Made Active in Reports: 08/09/2017 Number of Days to Update: 106 Source: Public Health Department Telephone: 530-538-7149 Last EDR Contact: 04/08/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: No Update Planned CALVERAS COUNTY: CUPA CALVERAS: CUPA Facility Listing Cupa Facility Listing Date of Government Version: 01/24/2019 Date Data Arrived at EDR: 01/25/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 39 Source: Calveras County Environmental Health Telephone: 209-754-6399 Last EDR Contact: 03/25/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly COLUSA COUNTY: CUPA COLUSA: CUPA Facility List Cupa facility list. Date of Government Version: 02/27/2019 Date Data Arrived at EDR: 02/28/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 32 Source: Health & Human Services Telephone: 530-458-0396 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Semi-Annually CONTRA COSTA COUNTY: SL CONTRA COSTA: Site List List includes sites from the underground tank, hazardous waste generator and business plan/2185 programs. Date of Government Version: 02/14/2019 Date Data Arrived at EDR: 02/19/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 17 Source: Contra Costa Health Services Department Telephone: 925-646-2286 Last EDR Contact: 04/29/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Semi-Annually DEL NORTE COUNTY: TC5646263.2s Page GR-35 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA DEL NORTE: CUPA Facility List Cupa Facility list Date of Government Version: 01/16/2019 Date Data Arrived at EDR: 02/05/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 28 Source: Del Norte County Environmental Health Division Telephone: 707-465-0426 Last EDR Contact: 04/25/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies EL DORADO COUNTY: CUPA EL DORADO: CUPA Facility List CUPA facility list. Date of Government Version: 02/27/2019 Date Data Arrived at EDR: 02/28/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 32 Source: El Dorado County Environmental Management Department Telephone: 530-621-6623 Last EDR Contact: 04/29/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies FRESNO COUNTY: CUPA FRESNO: CUPA Resources List Certified Unified Program Agency. CUPA’s are responsible for implementing a unified hazardous materials and hazardous waste management regulatory program. The agency provides oversight of businesses that deal with hazardous materials, operate underground storage tanks or aboveground storage tanks. Date of Government Version: 04/10/2019 Date Data Arrived at EDR: 04/11/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 19 Source: Dept. of Community Health Telephone: 559-445-3271 Last EDR Contact: 03/29/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Semi-Annually GLENN COUNTY: CUPA GLENN: CUPA Facility List Cupa facility list Date of Government Version: 01/22/2018 Date Data Arrived at EDR: 01/24/2018 Date Made Active in Reports: 03/14/2018 Number of Days to Update: 49 Source: Glenn County Air Pollution Control District Telephone: 830-934-6500 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies HUMBOLDT COUNTY: CUPA HUMBOLDT: CUPA Facility List CUPA facility list. Date of Government Version: 12/11/2018 Date Data Arrived at EDR: 12/13/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 33 Source: Humboldt County Environmental Health Telephone: N/A Last EDR Contact: 11/19/2018 Next Scheduled EDR Contact: 03/04/2019 Data Release Frequency: Semi-Annually IMPERIAL COUNTY: TC5646263.2s Page GR-36 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA IMPERIAL: CUPA Facility List Cupa facility list. Date of Government Version: 01/18/2019 Date Data Arrived at EDR: 01/23/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 41 Source: San Diego Border Field Office Telephone: 760-339-2777 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies INYO COUNTY: CUPA INYO: CUPA Facility List Cupa facility list. Date of Government Version: 04/02/2018 Date Data Arrived at EDR: 04/03/2018 Date Made Active in Reports: 06/14/2018 Number of Days to Update: 72 Source: Inyo County Environmental Health Services Telephone: 760-878-0238 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies KERN COUNTY: UST KERN: Underground Storage Tank Sites & Tank Listing Kern County Sites and Tanks Listing. Date of Government Version: 01/28/2019 Date Data Arrived at EDR: 02/07/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 29 Source: Kern County Environment Health Services Department Telephone: 661-862-8700 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly KINGS COUNTY: CUPA KINGS: CUPA Facility List A listing of sites included in the county’s Certified Unified Program Agency database. California’s Secretary for Environmental Protection established the unified hazardous materials and hazardous waste regulatory program as required by chapter 6.11 of the California Health and Safety Code. The Unified Program consolidates the administration, permits, inspections, and enforcement activities. Date of Government Version: 02/14/2019 Date Data Arrived at EDR: 02/19/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 14 Source: Kings County Department of Public Health Telephone: 559-584-1411 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies LAKE COUNTY: CUPA LAKE: CUPA Facility List Cupa facility list Date of Government Version: 02/08/2019 Date Data Arrived at EDR: 02/12/2019 Date Made Active in Reports: 03/12/2019 Number of Days to Update: 28 Source: Lake County Environmental Health Telephone: 707-263-1164 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Varies LASSEN COUNTY: TC5646263.2s Page GR-37 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA LASSEN: CUPA Facility List Cupa facility list Date of Government Version: 01/17/2019 Date Data Arrived at EDR: 01/18/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 46 Source: Lassen County Environmental Health Telephone: 530-251-8528 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies LOS ANGELES COUNTY: AOCONCERN: Key Areas of Concerns in Los Angeles County San Gabriel Valley areas where VOC contamination is at or above the MCL as designated by region 9 EPA office. Date of Government Version: 3/30/2009 Exide Site area is a cleanup plan of lead-impacted soil surrounding the former Exide Facility as designated by the DTSC. Date of Government Version: 7/17/2017 Date of Government Version: 03/30/2009 Date Data Arrived at EDR: 03/31/2009 Date Made Active in Reports: 10/23/2009 Number of Days to Update: 206 Source: N/A Telephone: N/A Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: No Update Planned HMS LOS ANGELES: HMS: Street Number List Industrial Waste and Underground Storage Tank Sites. Date of Government Version: 12/19/2018 Date Data Arrived at EDR: 01/10/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 56 Source: Department of Public Works Telephone: 626-458-3517 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Semi-Annually LF LOS ANGELES: List of Solid Waste Facilities Solid Waste Facilities in Los Angeles County. Date of Government Version: 01/14/2019 Date Data Arrived at EDR: 01/15/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 51 Source: La County Department of Public Works Telephone: 818-458-5185 Last EDR Contact: 04/16/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Varies LF LOS ANGELES CITY: City of Los Angeles Landfills Landfills owned and maintained by the City of Los Angeles. Date of Government Version: 01/01/2019 Date Data Arrived at EDR: 01/15/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 51 Source: Engineering & Construction Division Telephone: 213-473-7869 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Varies SITE MIT LOS ANGELES: Site Mitigation List Industrial sites that have had some sort of spill or complaint. Date of Government Version: 01/30/2019 Date Data Arrived at EDR: 02/01/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 34 Source: Community Health Services Telephone: 323-890-7806 Last EDR Contact: 04/16/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Annually TC5646263.2s Page GR-38 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING UST EL SEGUNDO: City of El Segundo Underground Storage Tank Underground storage tank sites located in El Segundo city. Date of Government Version: 01/21/2017 Date Data Arrived at EDR: 04/19/2017 Date Made Active in Reports: 05/10/2017 Number of Days to Update: 21 Source: City of El Segundo Fire Department Telephone: 310-524-2236 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Semi-Annually UST LONG BEACH: City of Long Beach Underground Storage Tank Underground storage tank sites located in the city of Long Beach. Date of Government Version: 03/09/2017 Date Data Arrived at EDR: 03/10/2017 Date Made Active in Reports: 05/03/2017 Number of Days to Update: 54 Source: City of Long Beach Fire Department Telephone: 562-570-2563 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Annually UST TORRANCE: City of Torrance Underground Storage Tank Underground storage tank sites located in the city of Torrance. Date of Government Version: 10/02/2018 Date Data Arrived at EDR: 10/05/2018 Date Made Active in Reports: 11/02/2018 Number of Days to Update: 28 Source: City of Torrance Fire Department Telephone: 310-618-2973 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Semi-Annually MADERA COUNTY: CUPA MADERA: CUPA Facility List A listing of sites included in the county’s Certified Unified Program Agency database. California’s Secretary for Environmental Protection established the unified hazardous materials and hazardous waste regulatory program as required by chapter 6.11 of the California Health and Safety Code. The Unified Program consolidates the administration, permits, inspections, and enforcement activities. Date of Government Version: 02/20/2019 Date Data Arrived at EDR: 02/22/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 13 Source: Madera County Environmental Health Telephone: 559-675-7823 Last EDR Contact: 02/15/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies MARIN COUNTY: UST MARIN: Underground Storage Tank Sites Currently permitted USTs in Marin County. Date of Government Version: 09/26/2018 Date Data Arrived at EDR: 10/04/2018 Date Made Active in Reports: 11/02/2018 Number of Days to Update: 29 Source: Public Works Department Waste Management Telephone: 415-473-6647 Last EDR Contact: 03/29/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Semi-Annually MERCED COUNTY: CUPA MERCED: CUPA Facility List CUPA facility list. TC5646263.2s Page GR-39 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 08/29/2018 Date Data Arrived at EDR: 08/31/2018 Date Made Active in Reports: 09/19/2018 Number of Days to Update: 19 Source: Merced County Environmental Health Telephone: 209-381-1094 Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies MONO COUNTY: CUPA MONO: CUPA Facility List CUPA Facility List Date of Government Version: 02/21/2019 Date Data Arrived at EDR: 02/26/2019 Date Made Active in Reports: 04/01/2019 Number of Days to Update: 34 Source: Mono County Health Department Telephone: 760-932-5580 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Varies MONTEREY COUNTY: CUPA MONTEREY: CUPA Facility Listing CUPA Program listing from the Environmental Health Division. Date of Government Version: 02/05/2019 Date Data Arrived at EDR: 02/07/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 26 Source: Monterey County Health Department Telephone: 831-796-1297 Last EDR Contact: 04/01/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Varies NAPA COUNTY: LUST NAPA: Sites With Reported Contamination A listing of leaking underground storage tank sites located in Napa county. Date of Government Version: 01/09/2017 Date Data Arrived at EDR: 01/11/2017 Date Made Active in Reports: 03/02/2017 Number of Days to Update: 50 Source: Napa County Department of Environmental Management Telephone: 707-253-4269 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: No Update Planned UST NAPA: Closed and Operating Underground Storage Tank Sites Underground storage tank sites located in Napa county. Date of Government Version: 02/21/2019 Date Data Arrived at EDR: 02/22/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 14 Source: Napa County Department of Environmental Management Telephone: 707-253-4269 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: No Update Planned NEVADA COUNTY: CUPA NEVADA: CUPA Facility List CUPA facility list. Date of Government Version: 01/25/2019 Date Data Arrived at EDR: 01/29/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 35 Source: Community Development Agency Telephone: 530-265-1467 Last EDR Contact: 04/25/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies ORANGE COUNTY: TC5646263.2s Page GR-40 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING IND_SITE ORANGE: List of Industrial Site Cleanups Petroleum and non-petroleum spills. Date of Government Version: 01/02/2019 Date Data Arrived at EDR: 02/07/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 26 Source: Health Care Agency Telephone: 714-834-3446 Last EDR Contact: 05/06/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Annually LUST ORANGE: List of Underground Storage Tank Cleanups Orange County Underground Storage Tank Cleanups (LUST). Date of Government Version: 01/02/2019 Date Data Arrived at EDR: 02/08/2019 Date Made Active in Reports: 03/06/2019 Number of Days to Update: 26 Source: Health Care Agency Telephone: 714-834-3446 Last EDR Contact: 05/06/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly UST ORANGE: List of Underground Storage Tank Facilities Orange County Underground Storage Tank Facilities (UST). Date of Government Version: 01/02/2019 Date Data Arrived at EDR: 02/05/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 31 Source: Health Care Agency Telephone: 714-834-3446 Last EDR Contact: 05/07/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly PLACER COUNTY: MS PLACER: Master List of Facilities List includes aboveground tanks, underground tanks and cleanup sites. Date of Government Version: 02/28/2019 Date Data Arrived at EDR: 03/01/2019 Date Made Active in Reports: 04/12/2019 Number of Days to Update: 42 Source: Placer County Health and Human Services Telephone: 530-745-2363 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Semi-Annually PLUMAS COUNTY: CUPA PLUMAS: CUPA Facility List Plumas County CUPA Program facilities. Date of Government Version: 01/14/2019 Date Data Arrived at EDR: 01/18/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 46 Source: Plumas County Environmental Health Telephone: 530-283-6355 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies RIVERSIDE COUNTY: LUST RIVERSIDE: Listing of Underground Tank Cleanup Sites Riverside County Underground Storage Tank Cleanup Sites (LUST). Date of Government Version: 04/11/2019 Date Data Arrived at EDR: 04/12/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 18 Source: Department of Environmental Health Telephone: 951-358-5055 Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Quarterly TC5646263.2s Page GR-41 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING UST RIVERSIDE: Underground Storage Tank Tank List Underground storage tank sites located in Riverside county. Date of Government Version: 01/29/2019 Date Data Arrived at EDR: 01/31/2019 Date Made Active in Reports: 03/08/2019 Number of Days to Update: 36 Source: Department of Environmental Health Telephone: 951-358-5055 Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Quarterly SACRAMENTO COUNTY: CS SACRAMENTO: Toxic Site Clean-Up List List of sites where unauthorized releases of potentially hazardous materials have occurred. Date of Government Version: 11/07/2018 Date Data Arrived at EDR: 01/04/2019 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 60 Source: Sacramento County Environmental Management Telephone: 916-875-8406 Last EDR Contact: 04/02/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly ML SACRAMENTO: Master Hazardous Materials Facility List Any business that has hazardous materials on site - hazardous material storage sites, underground storage tanks, waste generators. Date of Government Version: 11/07/2018 Date Data Arrived at EDR: 12/28/2018 Date Made Active in Reports: 03/05/2019 Number of Days to Update: 67 Source: Sacramento County Environmental Management Telephone: 916-875-8406 Last EDR Contact: 04/02/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Quarterly SAN BENITO COUNTY: CUPA SAN BENITO: CUPA Facility List Cupa facility list Date of Government Version: 03/11/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 48 Source: San Benito County Environmental Health Telephone: N/A Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies SAN BERNARDINO COUNTY: PERMITS SAN BERNARDINO: Hazardous Material Permits This listing includes underground storage tanks, medical waste handlers/generators, hazardous materials handlers, hazardous waste generators, and waste oil generators/handlers. Date of Government Version: 02/27/2019 Date Data Arrived at EDR: 02/28/2019 Date Made Active in Reports: 04/02/2019 Number of Days to Update: 33 Source: San Bernardino County Fire Department Hazardous Materials Division Telephone: 909-387-3041 Last EDR Contact: 05/06/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly SAN DIEGO COUNTY: TC5646263.2s Page GR-42 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING HMMD SAN DIEGO: Hazardous Materials Management Division Database The database includes: HE58 - This report contains the business name, site address, business phone number, establishment ’H’ permit number, type of permit, and the business status. HE17 - In addition to providing the same information provided in the HE58 listing, HE17 provides inspection dates, violations received by the establishment, hazardous waste generated, the quantity, method of storage, treatment/disposal of waste and the hauler, and information on underground storage tanks. Unauthorized Release List - Includes a summary of environmental contamination cases in San Diego County (underground tank cases, non-tank cases, groundwater contamination, and soil contamination are included.) Date of Government Version: 03/04/2019 Date Data Arrived at EDR: 03/05/2019 Date Made Active in Reports: 04/02/2019 Number of Days to Update: 28 Source: Hazardous Materials Management Division Telephone: 619-338-2268 Last EDR Contact: 03/05/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Quarterly LF SAN DIEGO: Solid Waste Facilities San Diego County Solid Waste Facilities. Date of Government Version: 04/18/2018 Date Data Arrived at EDR: 04/24/2018 Date Made Active in Reports: 06/19/2018 Number of Days to Update: 56 Source: Department of Health Services Telephone: 619-338-2209 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies SAN DIEGO CO LOP: Local Oversight Program Listing A listing of all LOP release sites that are or were under the County of San Diego’s jurisdiction. Included are closed or transferred cases, open cases, and cases that did not have a case type indicated. The cases without a case type are mostly complaints; however, some of them could be LOP cases. Date of Government Version: 03/06/2019 Date Data Arrived at EDR: 03/06/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 54 Source: Department of Environmental Health Telephone: 858-505-6874 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies SAN DIEGO CO. SAM: Environmental Case Listing The listing contains all underground tank release cases and projects pertaining to properties contaminated with hazardous substances that are actively under review by the Site Assessment and Mitigation Program. Date of Government Version: 03/23/2010 Date Data Arrived at EDR: 06/15/2010 Date Made Active in Reports: 07/09/2010 Number of Days to Update: 24 Source: San Diego County Department of Environmental Health Telephone: 619-338-2371 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: No Update Planned SAN FRANCISCO COUNTY: LUST SAN FRANCISCO: Local Oversite Facilities A listing of leaking underground storage tank sites located in San Francisco county. Date of Government Version: 09/19/2008 Date Data Arrived at EDR: 09/19/2008 Date Made Active in Reports: 09/29/2008 Number of Days to Update: 10 Source: Department Of Public Health San Francisco County Telephone: 415-252-3920 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly UST SAN FRANCISCO: Underground Storage Tank Information Underground storage tank sites located in San Francisco county. TC5646263.2s Page GR-43 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 11/05/2018 Date Data Arrived at EDR: 11/06/2018 Date Made Active in Reports: 12/14/2018 Number of Days to Update: 38 Source: Department of Public Health Telephone: 415-252-3920 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Quarterly SAN JOAQUIN COUNTY: UST SAN JOAQUIN: San Joaquin Co. UST A listing of underground storage tank locations in San Joaquin county. Date of Government Version: 06/22/2018 Date Data Arrived at EDR: 06/26/2018 Date Made Active in Reports: 07/11/2018 Number of Days to Update: 15 Source: Environmental Health Department Telephone: N/A Last EDR Contact: 03/18/2019 Next Scheduled EDR Contact: 07/01/2019 Data Release Frequency: Semi-Annually SAN LUIS OBISPO COUNTY: CUPA SAN LUIS OBISPO: CUPA Facility List Cupa Facility List. Date of Government Version: 02/13/2019 Date Data Arrived at EDR: 02/15/2019 Date Made Active in Reports: 03/14/2019 Number of Days to Update: 27 Source: San Luis Obispo County Public Health Department Telephone: 805-781-5596 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies SAN MATEO COUNTY: BI SAN MATEO: Business Inventory List includes Hazardous Materials Business Plan, hazardous waste generators, and underground storage tanks. Date of Government Version: 03/04/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 47 Source: San Mateo County Environmental Health Services Division Telephone: 650-363-1921 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Annually LUST SAN MATEO: Fuel Leak List A listing of leaking underground storage tank sites located in San Mateo county. Date of Government Version: 12/13/2018 Date Data Arrived at EDR: 12/18/2018 Date Made Active in Reports: 01/23/2019 Number of Days to Update: 36 Source: San Mateo County Environmental Health Services Division Telephone: 650-363-1921 Last EDR Contact: 03/25/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Semi-Annually SANTA BARBARA COUNTY: CUPA SANTA BARBARA: CUPA Facility Listing CUPA Program Listing from the Environmental Health Services division. Date of Government Version: 09/08/2011 Date Data Arrived at EDR: 09/09/2011 Date Made Active in Reports: 10/07/2011 Number of Days to Update: 28 Source: Santa Barbara County Public Health Department Telephone: 805-686-8167 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies SANTA CLARA COUNTY: TC5646263.2s Page GR-44 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA SANTA CLARA: Cupa Facility List Cupa facility list Date of Government Version: 02/13/2019 Date Data Arrived at EDR: 02/19/2019 Date Made Active in Reports: 03/06/2019 Number of Days to Update: 15 Source: Department of Environmental Health Telephone: 408-918-1973 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies HIST LUST SANTA CLARA: HIST LUST - Fuel Leak Site Activity Report A listing of open and closed leaking underground storage tanks. This listing is no longer updated by the county. Leaking underground storage tanks are now handled by the Department of Environmental Health. Date of Government Version: 03/29/2005 Date Data Arrived at EDR: 03/30/2005 Date Made Active in Reports: 04/21/2005 Number of Days to Update: 22 Source: Santa Clara Valley Water District Telephone: 408-265-2600 Last EDR Contact: 03/23/2009 Next Scheduled EDR Contact: 06/22/2009 Data Release Frequency: No Update Planned LUST SANTA CLARA: LOP Listing A listing of leaking underground storage tanks located in Santa Clara county. Date of Government Version: 03/03/2014 Date Data Arrived at EDR: 03/05/2014 Date Made Active in Reports: 03/18/2014 Number of Days to Update: 13 Source: Department of Environmental Health Telephone: 408-918-3417 Last EDR Contact: 02/21/2019 Next Scheduled EDR Contact: 06/10/2019 Data Release Frequency: Annually SAN JOSE HAZMAT: Hazardous Material Facilities Hazardous material facilities, including underground storage tank sites. Date of Government Version: 01/30/2019 Date Data Arrived at EDR: 02/01/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 34 Source: City of San Jose Fire Department Telephone: 408-535-7694 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Annually SANTA CRUZ COUNTY: CUPA SANTA CRUZ: CUPA Facility List CUPA facility listing. Date of Government Version: 01/21/2017 Date Data Arrived at EDR: 02/22/2017 Date Made Active in Reports: 05/23/2017 Number of Days to Update: 90 Source: Santa Cruz County Environmental Health Telephone: 831-464-2761 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies SHASTA COUNTY: CUPA SHASTA: CUPA Facility List Cupa Facility List. Date of Government Version: 06/15/2017 Date Data Arrived at EDR: 06/19/2017 Date Made Active in Reports: 08/09/2017 Number of Days to Update: 51 Source: Shasta County Department of Resource Management Telephone: 530-225-5789 Last EDR Contact: 02/13/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Varies SOLANO COUNTY: TC5646263.2s Page GR-45 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING LUST SOLANO: Leaking Underground Storage Tanks A listing of leaking underground storage tank sites located in Solano county. Date of Government Version: 03/05/2019 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 04/29/2019 Number of Days to Update: 53 Source: Solano County Department of Environmental Management Telephone: 707-784-6770 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Quarterly UST SOLANO: Underground Storage Tanks Underground storage tank sites located in Solano county. Date of Government Version: 03/05/2019 Date Data Arrived at EDR: 03/07/2019 Date Made Active in Reports: 04/03/2019 Number of Days to Update: 27 Source: Solano County Department of Environmental Management Telephone: 707-784-6770 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Quarterly SONOMA COUNTY: CUPA SONOMA: Cupa Facility List Cupa Facility list Date of Government Version: 03/18/2019 Date Data Arrived at EDR: 03/26/2019 Date Made Active in Reports: 05/01/2019 Number of Days to Update: 36 Source: County of Sonoma Fire & Emergency Services Department Telephone: 707-565-1174 Last EDR Contact: 03/25/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Varies LUST SONOMA: Leaking Underground Storage Tank Sites A listing of leaking underground storage tank sites located in Sonoma county. Date of Government Version: 04/03/2019 Date Data Arrived at EDR: 04/11/2019 Date Made Active in Reports: 04/30/2019 Number of Days to Update: 19 Source: Department of Health Services Telephone: 707-565-6565 Last EDR Contact: 04/08/2019 Next Scheduled EDR Contact: 07/08/2019 Data Release Frequency: Quarterly STANISLAUS COUNTY: CUPA STANISLAUS: CUPA Facility List Cupa facility list Date of Government Version: 12/11/2018 Date Data Arrived at EDR: 12/13/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 33 Source: Stanislaus County Department of Ennvironmental Protection Telephone: 209-525-6751 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Varies SUTTER COUNTY: UST SUTTER: Underground Storage Tanks Underground storage tank sites located in Sutter county. Date of Government Version: 02/28/2019 Date Data Arrived at EDR: 03/01/2019 Date Made Active in Reports: 04/03/2019 Number of Days to Update: 33 Source: Sutter County Environmental Health Services Telephone: 530-822-7500 Last EDR Contact: 02/27/2019 Next Scheduled EDR Contact: 06/17/2019 Data Release Frequency: Semi-Annually TEHAMA COUNTY: TC5646263.2s Page GR-46 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING CUPA TEHAMA: CUPA Facility List Cupa facilities Date of Government Version: 12/13/2018 Date Data Arrived at EDR: 12/18/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 28 Source: Tehama County Department of Environmental Health Telephone: 530-527-8020 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies TRINITY COUNTY: CUPA TRINITY: CUPA Facility List Cupa facility list Date of Government Version: 01/18/2019 Date Data Arrived at EDR: 01/23/2019 Date Made Active in Reports: 03/06/2019 Number of Days to Update: 42 Source: Department of Toxic Substances Control Telephone: 760-352-0381 Last EDR Contact: 04/22/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies TULARE COUNTY: CUPA TULARE: CUPA Facility List Cupa program facilities Date of Government Version: 12/26/2018 Date Data Arrived at EDR: 12/27/2018 Date Made Active in Reports: 01/15/2019 Number of Days to Update: 19 Source: Tulare County Environmental Health Services Division Telephone: 559-624-7400 Last EDR Contact: 05/06/2019 Next Scheduled EDR Contact: 08/19/2019 Data Release Frequency: Varies TUOLUMNE COUNTY: CUPA TUOLUMNE: CUPA Facility List Cupa facility list Date of Government Version: 04/23/2018 Date Data Arrived at EDR: 04/25/2018 Date Made Active in Reports: 06/25/2018 Number of Days to Update: 61 Source: Divison of Environmental Health Telephone: 209-533-5633 Last EDR Contact: 05/02/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Varies VENTURA COUNTY: BWT VENTURA: Business Plan, Hazardous Waste Producers, and Operating Underground Tanks The BWT list indicates by site address whether the Environmental Health Division has Business Plan (B), Waste Producer (W), and/or Underground Tank (T) information. Date of Government Version: 12/26/2018 Date Data Arrived at EDR: 01/24/2019 Date Made Active in Reports: 02/28/2019 Number of Days to Update: 35 Source: Ventura County Environmental Health Division Telephone: 805-654-2813 Last EDR Contact: 04/23/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Quarterly LF VENTURA: Inventory of Illegal Abandoned and Inactive Sites Ventura County Inventory of Closed, Illegal Abandoned, and Inactive Sites. TC5646263.2s Page GR-47 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 12/01/2011 Date Data Arrived at EDR: 12/01/2011 Date Made Active in Reports: 01/19/2012 Number of Days to Update: 49 Source: Environmental Health Division Telephone: 805-654-2813 Last EDR Contact: 03/29/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Annually LUST VENTURA: Listing of Underground Tank Cleanup Sites Ventura County Underground Storage Tank Cleanup Sites (LUST). Date of Government Version: 05/29/2008 Date Data Arrived at EDR: 06/24/2008 Date Made Active in Reports: 07/31/2008 Number of Days to Update: 37 Source: Environmental Health Division Telephone: 805-654-2813 Last EDR Contact: 02/07/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: Quarterly MED WASTE VENTURA: Medical Waste Program List To protect public health and safety and the environment from potential exposure to disease causing agents, the Environmental Health Division Medical Waste Program regulates the generation, handling, storage, treatment and disposal of medical waste throughout the County. Date of Government Version: 12/26/2018 Date Data Arrived at EDR: 01/24/2019 Date Made Active in Reports: 03/07/2019 Number of Days to Update: 42 Source: Ventura County Resource Management Agency Telephone: 805-654-2813 Last EDR Contact: 04/23/2019 Next Scheduled EDR Contact: 08/05/2019 Data Release Frequency: Quarterly UST VENTURA: Underground Tank Closed Sites List Ventura County Operating Underground Storage Tank Sites (UST)/Underground Tank Closed Sites List. Date of Government Version: 02/26/2019 Date Data Arrived at EDR: 03/13/2019 Date Made Active in Reports: 04/03/2019 Number of Days to Update: 21 Source: Environmental Health Division Telephone: 805-654-2813 Last EDR Contact: 03/13/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Quarterly YOLO COUNTY: UST YOLO: Underground Storage Tank Comprehensive Facility Report Underground storage tank sites located in Yolo county. Date of Government Version: 12/26/2018 Date Data Arrived at EDR: 01/03/2019 Date Made Active in Reports: 01/16/2019 Number of Days to Update: 13 Source: Yolo County Department of Health Telephone: 530-666-8646 Last EDR Contact: 03/29/2019 Next Scheduled EDR Contact: 07/15/2019 Data Release Frequency: Annually YUBA COUNTY: CUPA YUBA: CUPA Facility List CUPA facility listing for Yuba County. Date of Government Version: 02/08/2019 Date Data Arrived at EDR: 02/12/2019 Date Made Active in Reports: 03/06/2019 Number of Days to Update: 22 Source: Yuba County Environmental Health Department Telephone: 530-749-7523 Last EDR Contact: 04/25/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Varies TC5646263.2s Page GR-48 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING OTHER DATABASE(S) Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily mean that wetlands do not exist in the area covered by the report. CT MANIFEST: Hazardous Waste Manifest Data Facility and manifest data. Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a tsd facility. Date of Government Version: 02/11/2019 Date Data Arrived at EDR: 02/12/2019 Date Made Active in Reports: 03/04/2019 Number of Days to Update: 20 Source: Department of Energy & Environmental Protection Telephone: 860-424-3375 Last EDR Contact: 02/12/2019 Next Scheduled EDR Contact: 05/27/2019 Data Release Frequency: No Update Planned NJ MANIFEST: Manifest Information Hazardous waste manifest information. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 07/13/2018 Date Made Active in Reports: 08/01/2018 Number of Days to Update: 19 Source: Department of Environmental Protection Telephone: N/A Last EDR Contact: 04/10/2019 Next Scheduled EDR Contact: 07/22/2019 Data Release Frequency: Annually NY MANIFEST: Facility and Manifest Data Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a TSD facility. Date of Government Version: 01/01/2019 Date Data Arrived at EDR: 01/30/2019 Date Made Active in Reports: 02/14/2019 Number of Days to Update: 15 Source: Department of Environmental Conservation Telephone: 518-402-8651 Last EDR Contact: 05/01/2019 Next Scheduled EDR Contact: 08/12/2019 Data Release Frequency: Quarterly PA MANIFEST: Manifest Information Hazardous waste manifest information. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 10/23/2018 Date Made Active in Reports: 11/27/2018 Number of Days to Update: 35 Source: Department of Environmental Protection Telephone: 717-783-8990 Last EDR Contact: 04/15/2019 Next Scheduled EDR Contact: 07/29/2019 Data Release Frequency: Annually RI MANIFEST: Manifest information Hazardous waste manifest information Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 02/23/2018 Date Made Active in Reports: 04/09/2018 Number of Days to Update: 45 Source: Department of Environmental Management Telephone: 401-222-2797 Last EDR Contact: 02/19/2019 Next Scheduled EDR Contact: 06/03/2019 Data Release Frequency: Annually WI MANIFEST: Manifest Information Hazardous waste manifest information. Date of Government Version: 12/31/2017 Date Data Arrived at EDR: 06/15/2018 Date Made Active in Reports: 07/09/2018 Number of Days to Update: 24 Source: Department of Natural Resources Telephone: N/A Last EDR Contact: 03/11/2019 Next Scheduled EDR Contact: 06/24/2019 Data Release Frequency: Annually TC5646263.2s Page GR-49 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Oil/Gas Pipelines Source: PennWell Corporation Petroleum Bundle (Crude Oil, Refined Products, Petrochemicals, Gas Liquids (LPG/NGL), and Specialty Gases (Miscellaneous)) N = Natural Gas Bundle (Natural Gas, Gas Liquids (LPG/NGL), and Specialty Gases (Miscellaneous)). This map includes information copyrighted by PennWell Corporation. This information is provided on a best effort basis and PennWell Corporation does not guarantee its accuracy nor warrant its fitness for any particular purpose. Such information has been reprinted with the permission of PennWell. Electric Power Transmission Line Data Source: PennWell Corporation This map includes information copyrighted by PennWell Corporation. This information is provided on a best effort basis and PennWell Corporation does not guarantee its accuracy nor warrant its fitness for any particular purpose. Such information has been reprinted with the permission of PennWell. Sensitive Receptors: There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivity to environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the location of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers, and nursing homes - where individuals who are sensitive receptors are likely to be located. AHA Hospitals: Source: American Hospital Association, Inc. Telephone: 312-280-5991 The database includes a listing of hospitals based on the American Hospital Association’s annual survey of hospitals. Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services Telephone: 410-786-3000 A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services, a federal agency within the U.S. Department of Health and Human Services. Nursing Homes Source: National Institutes of Health Telephone: 301-594-6248 Information on Medicare and Medicaid certified nursing homes in the United States. Public Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics’ primary database on elementary and secondary public education in the United States. It is a comprehensive, annual, national statistical database of all public elementary and secondary schools and school districts, which contains data that are comparable across all states. Private Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics’ primary database on private school locations in the United States. Daycare Centers: Licensed Facilities Source: Department of Social Services Telephone: 916-657-4041 Flood Zone Data: This data was obtained from the Federal Emergency Management Agency (FEMA). It depicts 100-year and 500-year flood zones as defined by FEMA. It includes the National Flood Hazard Layer (NFHL) which incorporates Flood Insurance Rate Map (FIRM) data and Q3 data from FEMA in areas not covered by NFHL. Source: FEMA Telephone: 877-336-2627 Date of Government Version: 2003, 2015 NWI: National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002, 2005 and 2010 from the U.S. Fish and Wildlife Service. State Wetlands Data: Wetland Inventory Source: Department of Fish and Wildlife Telephone: 916-445-0411 TC5646263.2s Page GR-50 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Current USGS 7.5 Minute Topographic Map Source: U.S. Geological Survey STREET AND ADDRESS INFORMATION © 2015 TomTom North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material. TC5646263.2s Page GR-51 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING TC5646263.2s Page A-1 geologic strata. of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics 2. Groundwater flow velocity. 1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components: forming an opinion about the impact of potential contaminant migration. EDR’s GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 2012Version Date: 5633745 LOS ALAMITOS, CATarget Property Map: USGS TOPOGRAPHIC MAP 32 ft. above sea levelElevation: 3740738.2UTM Y (Meters): 403541.2UTM X (Meters): Zone 11Universal Tranverse Mercator: 118.042085 - 118˚ 2’ 31.51’’Longitude (West): 33.804178 - 33˚ 48’ 15.04’’Latitude (North): TARGET PROPERTY COORDINATES LOS ALAMITOS, CA 90720 NOT REPORTED NOT REPORTED TARGET PROPERTY ADDRESS ®GEOCHECK - PHYSICAL SETTING SOURCE ADDENDUM® TC5646263.2s Page A-2 should be field verified. on a relative (not an absolute) basis. Relative elevation information between sites of close proximity Source: Topography has been determined from the USGS 7.5’ Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)Elevation (ft)TP TP 0 1/2 1 Miles✩Target Property Elevation: 32 ft. North South West East2727293131312730323233333333343433353626272828282930313132333536373839384041General SWGeneral Topographic Gradient: TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted. assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or, Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers). sources of information, such as surface topographic information, hydrologic information, hydrogeologic data using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-3 GENERAL DIRECTIONLOCATION GROUNDWATER FLOWFROM TPMAP ID hydrogeologically, and the depth to water table. authorities at select sites and has extracted the date of the report, groundwater flow direction as determined flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW® Search Radius: 1.000 Mile. * ©1996 Site-specific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation. Information is inferred in the CERCLIS investigation report(s) Data Quality: No information about a sole source aquifer is available Sole Source Aquifer: confining layers. aquifer at a depth of 40 to 100 feet. Lower aquifers are separated by The shallow perched aquifer is underlain by the Artesia water table Hydraulic Connection: 15 to 20 feet in the perched aquifer. Inferred Depth to Water: S TO SW ON A REGIONAL BASIS. Groundwater Flow Direction: CAD008302002 Site EPA ID Number: FEDERAL MOGUL CORP-ARROWHEAD PRODUCTS Site Name: 1/2 - 1 Mile West Location Relative to TP: 1.25 miles Search Radius: Site-Specific Hydrogeological Data*: * ©1996 Site-specific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation. contamination exist on the target property, what downgradient sites might be impacted. environmental professional in forming an opinion about the impact of nearby contaminated properties or, should of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail MapLOS ALAMITOS NATIONAL WETLAND INVENTORY NWI Electronic Data CoverageNWI Quad at Target Property Not Reported Additional Panels in search area:FEMA Source Type FEMA FIRM Flood data06037C2000F Flood Plain Panel at Target Property FEMA Source Type FEMA FLOOD ZONE and bodies of water). Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted. the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-4 For additional site information, refer to Physical Setting Source Map Findings. Varies1/8 - 1/4 Mile ESE7G SW1/2 - 1 Mile ENE5G SW1/2 - 1 Mile NNW4G Varies1/2 - 1 Mile NNW3G SW1/2 - 1 Mile NNW2G SSW1/2 - 1 Mile NNE1G SSW1/2 - 1 Mile NNE11 SW1/2 - 1 Mile NNWB10 Varies1/2 - 1 Mile NNWB9 SW1/2 - 1 Mile NNWB8 SW1/2 - 1 Mile ENEA6 Varies1/8 - 1/4 Mile ESE1 GENERAL DIRECTIONLOCATION GROUNDWATER FLOWFROM TPMAP ID ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-5 Map, USGS Digital Data Series DDS - 11 (1994). of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology ROCK STRATIGRAPHIC UNIT GEOLOGIC AGE IDENTIFICATION Stratifed SequenceCategory:CenozoicEra: QuaternarySystem: QuaternarySeries: QCode: (decoded above as Era, System & Series) at which contaminant migration may be occurring. Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils. characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 3 1 5 2 4 0 1/16 1/8 1/4 Miles TC5646263.2s Page A-7 Soil Drainage Class: textures. moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep,Hydrologic Group: fine sandy loamSoil Surface Texture: HUENEMESoil Component Name: Soil Map ID: 2 Min: 7.9 Max: 8.4 Min: 14 Max: 42 Not reportedNot reported loam very fine sandy coarse sand to gravelly loamy stratified61 inches 7 inches 2 Min: 7.9 Max: 8.4 Min: 14 Max: 42 Not reportedNot reportedfine sandy loam 7 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: HighCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric Well drainedSoil Drainage Class: textures. moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep,Hydrologic Group: fine sandy loamSoil Surface Texture: SAN EMIGDIOSoil Component Name: Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data. for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information The U.S. Department of Agriculture’s (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTY ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-8 Min: 7.9 Max: 8.4 Min: 1.4 Max: 4 Not reportedNot reportedsilty clay loam68 inches11 inches 2 Min: 7.9 Max: 8.4 Min: 1.4 Max: 4 Not reportedNot reportedsilt loam11 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: HighCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric Soil Drainage Class: movement of water, or soils with moderately fine or fine textures. Class C - Slow infiltration rates. Soils with layers impeding downwardHydrologic Group: silt loamSoil Surface Texture: BOLSASoil Component Name: Soil Map ID: 3 Min: 7.4 Max: 8.4 Min: 14 Max: 42 Not reportedNot reported to silt loam stratified sand59 inches27 inches 2 Min: 7.4 Max: 8.4 Min: 14 Max: 42 Not reportedNot reportedfine sandy loam27 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: HighCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-9 Soil Drainage Class: excessively drained sands and gravels. Class A - High infiltration rates. Soils are deep, well drained toHydrologic Group: loamy sandSoil Surface Texture: WaterSoil Component Name: Soil Map ID: 5 Min: 6.6 Max: 8.4 Min: 4 Max: 14 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED and Sand. Clayey Gravel 200), Silty, or passing No. pct. or less materials (35 Granular loam to fine sandy stratified sand62 inches16 inches 2 Min: 6.6 Max: 8.4 Min: 4 Max: 14 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED and Sand. Clayey Gravel 200), Silty, or passing No. pct. or less materials (35 Granularloamy sand16 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: HighCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric Somewhat excessively drainedSoil Drainage Class: excessively drained sands and gravels. Class A - High infiltration rates. Soils are deep, well drained toHydrologic Group: loamy sandSoil Surface Texture: METZSoil Component Name: Soil Map ID: 4 ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-10 1/2 - 1 Mile EastCADWR8000005596 C12 1/2 - 1 Mile North5250 5 1/2 - 1 Mile WSW5267 4 1/2 - 1 Mile WNWCADWR8000005622 3 1/4 - 1/2 Mile NW5247 2 STATE DATABASE WELL INFORMATION LOCATION FROM TPWELL IDMAP ID Note: PWS System location is not always the same as well location. No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATION FROM TPWELL IDMAP ID 1/2 - 1 Mile EastUSGS40000138297 C14 FEDERAL USGS WELL INFORMATION LOCATION FROM TPWELL IDMAP ID 1.000State Database Nearest PWS within 0.001 milesFederal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)DATABASE opinion about the impact of contaminant migration on nearby drinking water wells. professional in assessing sources that may impact ground water flow direction, and in forming an EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS No Layer Information available. > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: Not ReportedCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC5646263.2s Page A-11 1/2 - 1 Mile SSWCADWR8000005539 13 STATE DATABASE WELL INFORMATION LOCATION FROM TPWELL IDMAP ID ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 40 40 4040CA TC5646263.2s Page A-13 0.Dlr: PCI/LReport units:URANIUM COUNTING ERRORChemical: 1.52Finding:04-JAN-18Sample date: 1.Dlr: PCI/LReport units:URANIUM (PCI/L)Chemical: 5.65Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 COUNTING ERRORChemical: 0.697Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 MDA95Chemical: 0.4Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:RADIUM 226 COUNTING ERRORChemical: 6.9e-002Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA COUNTING ERRORChemical: 2.57Finding:04-JAN-18Sample date: 3.Dlr: PCI/LReport units:GROSS ALPHAChemical: 9.39Finding:04-JAN-18Sample date: Not ReportedArea serve: 0Connection:400Pop serv: Not ReportedZip ext:Not ReportedZip: Not ReportedState:Not ReportedCity: Not ReportedAddress:Not ReportedHqname: LOS ALAMITOS RACE COURSESystem nam:3000819System no: Not ReportedComment 7: Not ReportedComment 6:Not ReportedComment 5: Not ReportedComment 4:Not ReportedComment 3: Not ReportedComment 2:4961 KATELLA AVE LOS ALAMITOSComment 1: AUStatus:3Precision: 1180240.0Longitude:334825.0Latitude: WELL/AMBNT/MUN/INTAKEStation ty:WELL 01 DOMESTIC WELLSource nam: GWater type:3000819System no: TEEUser id:08District: 30County:3000819001Frds no: 04S/11W-20R02 SPrim sta c:5247Seq: 2 NW 1/4 - 1/2 Mile Higher 5247CA WELLS Date: 03/31/1999 Average Water Depth: Not Reported Deep Water Depth: 7.13 Shallow Water Depth: 4.75 Groundwater Flow: Varies Site ID: 083000585T1 ESE 1/8 - 1/4 Mile Higher 68297AQUIFLOW Map ID Direction Distance Elevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-14 MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.51Finding:05-JAN-15Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 63.8Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:CHLORIDEChemical: 26.4Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.6Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 34.8Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 14.1Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 61.2Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 211.Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 173.Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 173.Finding:05-JAN-15Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.9Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:BROMIDEChemical: 0.1Finding:05-JAN-15Sample date: 0.Dlr: UNITSReport units:COLORChemical: 5.Finding:05-JAN-15Sample date: 0.Dlr: PCI/LReport units:RADIUM 226 MDA95Chemical: 0.322Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:URANIUM MDA95Chemical: 0.47Finding:04-JAN-18Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA MDA95Chemical: 1.28Finding:04-JAN-18Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-15 0.Dlr: PCI/LReport units:URANIUM MDA95Chemical: 0.3Finding:01-JUL-14Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA MDA95Chemical: 1.11Finding:01-JUL-14Sample date: 0.Dlr: PCI/LReport units:URANIUM COUNTING ERRORChemical: 0.949Finding:01-JUL-14Sample date: 1.Dlr: PCI/LReport units:URANIUM (PCI/L)Chemical: 3.08Finding:01-JUL-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 COUNTING ERRORChemical: 0.449Finding:01-JUL-14Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA COUNTING ERRORChemical: 1.74Finding:01-JUL-14Sample date: 3.Dlr: PCI/LReport units:GROSS ALPHAChemical: 4.33Finding:01-JUL-14Sample date: 0.Dlr:PCI/LReport units: RADIUM, TOTAL, MDA95-NTNC ONLY, BY 903.0Chemical: 0.418Finding:01-JUL-14Sample date: 100.Dlr: UG/LReport units:IRONChemical: 134.Finding:01-JUL-14Sample date: 100.Dlr: UG/LReport units:IRONChemical: 128.Finding:22-OCT-14Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 541.Finding:05-JAN-15Sample date: 0.1Dlr: NTUReport units:TURBIDITY, LABORATORYChemical: 0.7Finding:05-JAN-15Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 334.Finding:05-JAN-15Sample date: 100.Dlr: UG/LReport units:IRONChemical: 142.Finding:05-JAN-15Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 4.7Finding:05-JAN-15Sample date: 0.1Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-16 MG/LReport units:CALCIUMChemical: 56.2Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 198.Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 175.Finding:03-JAN-12Sample date: 100.Dlr: UG/LReport units:IRONChemical: 155.Finding:30-APR-12Sample date: 100.Dlr: UG/LReport units:IRONChemical: 155.Finding:02-JUL-12Sample date: 100.Dlr: UG/LReport units:IRONChemical: 222.Finding:04-OCT-12Sample date: 100.Dlr: UG/LReport units:IRONChemical: 221.Finding:21-JAN-13Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 3.8Finding:11-APR-13Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 558.Finding:11-APR-13Sample date: 100.Dlr: UG/LReport units:IRONChemical: 152.Finding:02-JUL-13Sample date: 100.Dlr: UG/LReport units:IRONChemical: 201.Finding:09-OCT-13Sample date: 100.Dlr: UG/LReport units:IRONChemical: 146.Finding:16-JAN-14Sample date: 100.Dlr: UG/LReport units:IRONChemical: 194.Finding:03-APR-14Sample date: 0.Dlr: PCI/LReport units:RA-226 OR TOTAL RA BY 903.0 C.E.Chemical: 0.354Finding:01-JUL-14Sample date: 0.Dlr:PCI/LReport units: RA-226 FOR CWS OR TOTAL RA FOR NTNC BY 903.0Chemical: 0.451Finding:01-JUL-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 MDA95Chemical: 0.253Finding:01-JUL-14Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-17 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 542.Finding:03-JAN-12Sample date: 0.Dlr: UNITSReport units:COLORChemical: 4.Finding:03-JAN-12Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 8.Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 175.Finding:03-JAN-12Sample date: 0.1Dlr: NTUReport units:TURBIDITY, LABORATORYChemical: 0.7Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 325.Finding:03-JAN-12Sample date: 100.Dlr: UG/LReport units:IRONChemical: 215.Finding:03-JAN-12Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 4.4Finding:03-JAN-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.53Finding:03-JAN-12Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 61.1Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:CHLORIDEChemical: 25.9Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.4Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 34.4Finding:03-JAN-12Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 13.9Finding:03-JAN-12Sample date: 0.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-18 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 215.Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 176.Finding:17-MAR-16Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.5Finding:17-MAR-16Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 469.Finding:17-MAR-16Sample date: 1.Dlr: TONReport units:ODOR THRESHOLD @ 60 CChemical: 2.Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:AMMONIA (NH3-N)Chemical: 0.25Finding:04-APR-16Sample date: LOS ALAMITOSArea serve: 25347Connection:84737Pop serv: Not ReportedZip ext:92801Zip: CAState:ANAHEIMCity: 1920 W. CORPORATE WAYAddress:SOUTHERN CALIF WATER COHqname: Southern Calif WC - West OrangeSystem nam:3010022System no: Not ReportedComment 7: Not ReportedComment 6:Not ReportedComment 5: Not ReportedComment 4:Not ReportedComment 3: Not ReportedComment 2:Not ReportedComment 1: AUStatus:2Precision: 1180317.6Longitude:334805.8Latitude: WELL/AMBNT/MUN/INTAKE/SUPPLYStation ty:HOWARDSource nam: GWater type:3010022System no: TEEUser id:08District: 30County:3010022007Frds no: 04S/11W-29C01 SPrim sta c:5267Seq: 4 WSW 1/2 - 1 Mile Lower 5267CA WELLS Not ReportedWell Completion Rpt #: Coastal Plain Of Orange CountyBasin Name: 0Well Depth: UnknownWell Type: UnknownWell Use: Not ReportedWell Name: 6111Station ID: 04S11W20K002SState Well #: 3 WNW 1/2 - 1 Mile Lower CADWR8000005622CA WELLS Map ID Direction Distance Elevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-19 MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 160.Finding:12-FEB-15Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 45.Finding:12-FEB-15Sample date: 0.Dlr: MG/LReport units:AMMONIA (NH3-N)Chemical: 0.2Finding:02-NOV-15Sample date: 0.Dlr: MG/LReport units:AMMONIA (NH3-N)Chemical: 0.2Finding:07-DEC-15Sample date: 0.1Dlr: NTUReport units:TURBIDITY, LABORATORYChemical: 0.3Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 282.Finding:17-MAR-16Sample date: 100.Dlr: UG/LReport units:IRONChemical: 139.Finding:17-MAR-16Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 3.8Finding:17-MAR-16Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.59Finding:17-MAR-16Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 42.5Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:CHLORIDEChemical: 16.1Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.4Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 33.3Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 11.6Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 51.3Finding:17-MAR-16Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 176.Finding:17-MAR-16Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-20 0.Dlr: PCI/LReport units:GROSS ALPHA MDA95Chemical: 1.11Finding:19-MAR-14Sample date: 0.Dlr: PCI/LReport units:URANIUM MDA95Chemical: 0.3Finding:19-MAR-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 MDA95Chemical: 0.2Finding:19-MAR-14Sample date: 0.Dlr:PCI/LReport units: RA-226 FOR CWS OR TOTAL RA FOR NTNC BY 903.0Chemical: 9.4e-002Finding:19-MAR-14Sample date: 0.Dlr: PCI/LReport units:RA-226 OR TOTAL RA BY 903.0 C.E.Chemical: 0.138Finding:19-MAR-14Sample date: 0.Dlr:PCI/LReport units: RADIUM, TOTAL, MDA95-NTNC ONLY, BY 903.0Chemical: 0.418Finding:19-MAR-14Sample date: 3.Dlr: PCI/LReport units:GROSS ALPHAChemical: 3.93Finding:19-MAR-14Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 270.Finding:02-MAY-14Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.93Finding:02-MAY-14Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 160.Finding:02-MAY-14Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 47.Finding:02-MAY-14Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 11.Finding:02-MAY-14Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.95Finding:12-FEB-15Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 270.Finding:12-FEB-15Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 11.Finding:12-FEB-15Sample date: 0.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-21 MG/LReport units:CALCIUMChemical: 48.1Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 178.Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 165.Finding:13-MAR-13Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 41.7Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:CHLORIDEChemical: 15.5Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.4Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 31.6Finding:13-MAR-13Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.9Finding:13-MAR-13Sample date: 0.Dlr: UNITSReport units:COLORChemical: 3.Finding:13-MAR-13Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 462.Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 11.Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 178.Finding:13-MAR-13Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA COUNTING ERRORChemical: 1.62Finding:19-MAR-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 COUNTING ERRORChemical: 0.52Finding:19-MAR-14Sample date: 1.Dlr: PCI/LReport units:URANIUM (PCI/L)Chemical: 3.46Finding:19-MAR-14Sample date: 0.Dlr: PCI/LReport units:URANIUM COUNTING ERRORChemical: 1.14Finding:19-MAR-14Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-22 BUENA PARKArea serve: 18211Connection:72550Pop serv: Not ReportedZip ext:90620Zip: CAState:BUENA PARKCity: 6650 BEACH BLVDAddress:Not ReportedHqname: City of Buena ParkSystem nam:3010003System no: Not ReportedComment 7: Not ReportedComment 6:Not ReportedComment 5: Not ReportedComment 4:Not ReportedComment 3: Not ReportedComment 2:Not ReportedComment 1: AUStatus:2Precision: 1180229.3Longitude:334901.3Latitude: WELL/AMBNT/MUN/INTAKEStation ty:BALL WELLSource nam: GWater type:3010003System no: TEEUser id:08District: 30County:3010003017Frds no: 04S/11W-22D01 SPrim sta c:5250Seq: 5 North 1/2 - 1 Mile Higher 5250CA WELLS 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 270.Finding:09-JAN-13Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 11.Finding:09-JAN-13Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 46.Finding:09-JAN-13Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 160.Finding:09-JAN-13Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 8.2Finding:09-JAN-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.54Finding:13-MAR-13Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 4.5Finding:13-MAR-13Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 274.Finding:13-MAR-13Sample date: 0.1Dlr: NTUReport units:TURBIDITY, LABORATORYChemical: 0.2Finding:13-MAR-13Sample date: 0.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-23 MG/LReport units:CHLORIDEChemical: 35.5Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.9Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 38.8Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 13.5Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 76.7Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 247.Finding:06-APR-17Sample date: 0.4Dlr: MG/LReport units:NITRATE (AS N)Chemical: 1.09Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 216.Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 177.Finding:06-APR-17Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 7.9Finding:06-APR-17Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 625.Finding:06-APR-17Sample date: 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 1.09Finding:06-APR-17Sample date: 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 390.Finding:06-APR-17Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.46Finding:13-JUL-17Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 37.9Finding:13-JUL-17Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 27.3Finding:11-OCT-17Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-24 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 0.61Finding:26-APR-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 70.Finding:26-APR-16Sample date: 0.4Dlr: MG/LReport units:NITRATE (AS N)Chemical: 0.59Finding:26-APR-16Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:27-APR-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 68.Finding:29-JUN-16Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.48Finding:29-JUN-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 71.4Finding:29-JUN-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 62.8Finding:19-JUL-16Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:21-JUL-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 59.7Finding:22-NOV-16Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 64.8Finding:25-JAN-17Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 40.7Finding:06-APR-17Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 4.7Finding:06-APR-17Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.45Finding:06-APR-17Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 78.5Finding:06-APR-17Sample date: 0.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-25 UG/LReport units:MANGANESEChemical: 56.7Finding:29-OCT-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.49Finding:07-JAN-15Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 46.3Finding:21-JAN-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:04-FEB-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:03-APR-15Sample date: 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 1030.Finding:15-APR-15Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 46.7Finding:15-APR-15Sample date: 2.Dlr: MG/LReport units:NITRATE (AS NO3)Chemical: 4.5Finding:15-APR-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.51Finding:06-MAY-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:03-JUN-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:01-JUL-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:23-JUL-15Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 60.Finding:23-JUL-15Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:07-OCT-15Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 62.1Finding:21-OCT-15Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 58.9Finding:27-JAN-16Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-26 0.Dlr: MG/LReport units:TOTAL DISSOLVED SOLIDSChemical: 318.Finding:22-APR-14Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 64.2Finding:22-APR-14Sample date: 2.Dlr: UG/LReport units:ARSENICChemical: 4.8Finding:22-APR-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:22-APR-14Sample date: 0.5Dlr: MG/LReport units:SULFATEChemical: 59.6Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:CHLORIDEChemical: 24.5Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:POTASSIUMChemical: 2.5Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:SODIUMChemical: 37.Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:MAGNESIUMChemical: 9.9Finding:22-APR-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.48Finding:05-JUN-14Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 56.6Finding:05-JUN-14Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 55.Finding:05-JUN-14Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 49.8Finding:30-JUL-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:08-AUG-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:01-OCT-14Sample date: 20.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-27 MG/LReport units:HARDNESS (TOTAL) AS CACO3Chemical: 204.Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:CALCIUMChemical: 65.3Finding:22-APR-14Sample date: 0.Dlr:PCI/LReport units: RADIUM, TOTAL, MDA95-NTNC ONLY, BY 903.0Chemical: 0.47Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:RA-226 OR TOTAL RA BY 903.0 C.E.Chemical: 0.306Finding:22-APR-14Sample date: 0.Dlr:PCI/LReport units: RA-226 FOR CWS OR TOTAL RA FOR NTNC BY 903.0Chemical: 0.368Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 MDA95Chemical: 0.2Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:URANIUM MDA95Chemical: 0.3Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA MDA95Chemical: 1.11Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:URANIUM COUNTING ERRORChemical: 0.559Finding:22-APR-14Sample date: 1.Dlr: PCI/LReport units:URANIUM (PCI/L)Chemical: 1.04Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:RADIUM 228 COUNTING ERRORChemical: 0.437Finding:22-APR-14Sample date: 0.Dlr: PCI/LReport units:GROSS ALPHA COUNTING ERRORChemical: 1.41Finding:22-APR-14Sample date: 3.Dlr: PCI/LReport units:GROSS ALPHAChemical: 3.12Finding:22-APR-14Sample date: 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 570.Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:BROMIDEChemical: 0.11Finding:22-APR-14Sample date: 2.Dlr: MG/LReport units:NITRATE (AS NO3)Chemical: 2.5Finding:22-APR-14Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-28 2.Dlr: MG/LReport units:NITRATE (AS NO3)Chemical: 3.2Finding:24-APR-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:28-JUN-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:01-AUG-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.55Finding:11-SEP-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:06-NOV-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.46Finding:04-DEC-13Sample date: 20.Dlr: UG/LReport units:MANGANESEChemical: 70.Finding:04-DEC-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.45Finding:06-FEB-14Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.48Finding:02-APR-14Sample date: 0.1Dlr: NTUReport units:TURBIDITY, LABORATORYChemical: 0.2Finding:22-APR-14Sample date: 0.Dlr: UNITSReport units:COLORChemical: 5.Finding:22-APR-14Sample date: 0.Dlr: USReport units:SPECIFIC CONDUCTANCEChemical: 546.Finding:22-APR-14Sample date: 0.Dlr: Not ReportedReport units:PH, LABORATORYChemical: 8.Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:ALKALINITY (TOTAL) AS CACO3Chemical: 177.Finding:22-APR-14Sample date: 0.Dlr: MG/LReport units:BICARBONATE ALKALINITYChemical: 216.Finding:22-APR-14Sample date: 0.Dlr: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-29 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.65Finding:04-JAN-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.48Finding:08-FEB-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.49Finding:29-FEB-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.48Finding:04-APR-12Sample date: 2.Dlr: MG/LReport units:NITRATE (AS NO3)Chemical: 4.02Finding:02-MAY-12Sample date: 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 910.Finding:02-MAY-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.52Finding:02-MAY-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.6Finding:30-MAY-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.58Finding:05-DEC-12Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:08-JAN-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:30-JAN-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.46Finding:06-MAR-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.47Finding:10-APR-13Sample date: 0.4Dlr: MG/LReport units:NITRATE + NITRITE (AS N)Chemical: 730.Finding:24-APR-13Sample date: 0.1Dlr: MG/LReport units:FLUORIDE (F) (NATURAL-SOURCE)Chemical: 0.49Finding:24-APR-13Sample date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-30 Not ReportedWell Completion Rpt #: Coastal Plain Of Orange CountyBasin Name: 0Well Depth: UnknownWell Type: UnknownWell Use: Not ReportedWell Name: 28324Station ID: 04S11W27D001SState Well #: C12 East 1/2 - 1 Mile Higher CADWR8000005596CA WELLS Date: 02/10/1992 Average Water Depth: 8 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: SSW Site ID: 083001501T11 NNE 1/2 - 1 Mile Higher 38612AQUIFLOW Date: 10/15/1997 Average Water Depth: Not Reported Deep Water Depth: 6.92 Shallow Water Depth: 3.12 Groundwater Flow: SW Site ID: 083002183TB10 NNW 1/2 - 1 Mile Higher 68189AQUIFLOW Date: 09/04/1992 Average Water Depth: 10 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: Varies Site ID: 083001957TB9 NNW 1/2 - 1 Mile Higher 68214AQUIFLOW Date: 10/15/1997 Average Water Depth: Not Reported Deep Water Depth: 6.92 Shallow Water Depth: 3.12 Groundwater Flow: SW Site ID: 083002183TB8 NNW 1/2 - 1 Mile Higher 68190AQUIFLOW Date: 08/26/1992 Average Water Depth: 7.75 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: Not Reported Site ID: 083000718TA7 ENE 1/2 - 1 Mile Higher 66460AQUIFLOW Date: 07/26/1995 Average Water Depth: Not Reported Deep Water Depth: 8 Shallow Water Depth: 5 Groundwater Flow: SW Site ID: 083002920TA6 ENE 1/2 - 1 Mile Higher 68233AQUIFLOW Map ID Direction Distance Elevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-31 56.71Feet below surface: 1984-10-09Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 57.21Feet below surface: 1984-11-01Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 34.88Feet below surface: 1985-02-14Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 38.06Feet below surface: 1985-04-15Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 46.44Feet below surface: 1985-05-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 61.98Feet below surface: 1985-08-17Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 59.84Feet below surface: 1985-11-05Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 46.94Feet below surface: 1986-02-20Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 52.91Feet below surface: 1986-05-06Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 65.33Feet below surface: 1986-09-02Level reading date: 85Ground water levels,Number of Measurements: ftWell Hole Depth Units: 900Well Hole Depth: Not ReportedWell Depth Units: Not ReportedWell Depth: Not ReportedConstruction Date: Not ReportedAquifer Type: Not ReportedFormation Type: California Coastal Basin aquifersAquifer: Not ReportedContrib Drainage Area Unts: Not ReportedContrib Drainage Area: Not ReportedDrainage Area Units: Not ReportedDrainage Area: 18070201HUC: Not ReportedDescription: WellType: 004S011W27D001SMonitor Location: USGS California Water Science CenterOrganization Name: USGS-CAOrganization ID: C14 East 1/2 - 1 Mile Higher USGS40000138297FED USGS Not ReportedWell Completion Rpt #: Coastal Plain Of Orange CountyBasin Name: 0Well Depth: UnknownWell Type: UnknownWell Use: Not ReportedWell Name: 39310Station ID: 04S11W28N001SState Well #: 13 SSW 1/2 - 1 Mile Lower CADWR8000005539CA WELLS Map ID Direction Distance Elevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-32 Not ReportedNote: Not ReportedFeet to sea level: 45.30Feet below surface: 1982-04-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 59.25Feet below surface: 1982-07-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 56.12Feet below surface: 1982-11-04Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 41.23Feet below surface: 1983-02-10Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 41.50Feet below surface: 1983-05-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 42.34Feet below surface: 1983-05-12Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 50.40Feet below surface: 1983-06-09Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 55.27Feet below surface: 1983-07-05Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 57.98Feet below surface: 1983-08-02Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 58.72Feet below surface: 1983-09-01Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 48.31Feet below surface: 1983-10-13Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 46.89Feet below surface: 1983-11-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 27.74Feet below surface: 1984-02-16Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 30.31Feet below surface: 1984-03-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 33.17Feet below surface: 1984-04-02Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 36.76Feet below surface: 1984-05-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 51.54Feet below surface: 1984-06-04Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 56.72Feet below surface: 1984-07-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 60.86Feet below surface: 1984-08-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 61.47Feet below surface: 1984-09-06Level reading date: Not ReportedNote: Not ReportedFeet to sea level: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-33 Not ReportedNote: Not ReportedFeet to sea level: 66.10Feet below surface: 1975-10-31Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 58.60Feet below surface: 1976-01-06Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 51.30Feet below surface: 1976-03-09Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 62.40Feet below surface: 1976-05-05Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 65.50Feet below surface: 1976-10-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 60.90Feet below surface: 1977-01-13Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 62.41Feet below surface: 1978-09-25Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 60.58Feet below surface: 1978-11-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 47.63Feet below surface: 1979-02-05Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 48.95Feet below surface: 1979-05-02Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 49.32Feet below surface: 1979-08-01Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 54.90Feet below surface: 1979-11-15Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 46.37Feet below surface: 1980-02-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 48.08Feet below surface: 1980-06-10Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 54.03Feet below surface: 1980-08-26Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 53.05Feet below surface: 1980-10-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 40.76Feet below surface: 1981-02-05Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 41.10Feet below surface: 1981-05-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 57.22Feet below surface: 1981-07-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 53.54Feet below surface: 1981-11-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 38.40Feet below surface: 1982-01-29Level reading date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-34 Not ReportedNote: Not ReportedFeet to sea level: 40.50Feet below surface: 1972-02-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 45.70Feet below surface: 1972-04-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 54.90Feet below surface: 1972-06-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 58.70Feet below surface: 1972-09-11Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 54.90Feet below surface: 1972-10-31Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 48.60Feet below surface: 1973-01-04Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 48.30Feet below surface: 1973-03-01Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 47.80Feet below surface: 1973-05-09Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 61.80Feet below surface: 1973-07-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 61.30Feet below surface: 1973-09-06Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 60.40Feet below surface: 1973-10-31Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 47.50Feet below surface: 1974-01-23Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 50.20Feet below surface: 1974-03-18Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 47.20Feet below surface: 1974-04-30Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 62.90Feet below surface: 1974-07-02Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 75.80Feet below surface: 1974-08-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 57.40Feet below surface: 1974-10-30Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 50.70Feet below surface: 1975-01-03Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 46.80Feet below surface: 1975-03-18Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 65.50Feet below surface: 1975-06-26Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 65.30Feet below surface: 1975-08-29Level reading date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-35 Date: 10/15/1997 Average Water Depth: Not Reported Deep Water Depth: 6.92 Shallow Water Depth: 3.12 Groundwater Flow: SW Site ID: 083002183T2G NNW 1/2 - 1 Mile Lower 68190AQUIFLOW Date: 02/10/1992 Average Water Depth: 8 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: SSW Site ID: 083001501T1G NNE 1/2 - 1 Mile Lower 38612AQUIFLOW Not ReportedNote: Not ReportedFeet to sea level: 27.70Feet below surface: 1969-04-28Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 35.50Feet below surface: 1970-05-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 41.70Feet below surface: 1970-06-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 43.70Feet below surface: 1970-10-01Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 44.20Feet below surface: 1970-10-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 43.20Feet below surface: 1970-12-09Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 31.60Feet below surface: 1971-03-02Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 36.10Feet below surface: 1971-04-12Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 36.10Feet below surface: 1971-04-29Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 42.30Feet below surface: 1971-06-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 41.60Feet below surface: 1971-07-07Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 43.20Feet below surface: 1971-08-30Level reading date: Not ReportedNote: Not ReportedFeet to sea level: 43.40Feet below surface: 1971-11-01Level reading date: ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-36 Date: 03/31/1999 Average Water Depth: Not Reported Deep Water Depth: 7.13 Shallow Water Depth: 4.75 Groundwater Flow: Varies Site ID: 083000585T7G ESE 1/8 - 1/4 Mile Lower 68297AQUIFLOW Date: 08/26/1992 Average Water Depth: 7.75 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: Not Reported Site ID: 083000718T6G ENE 1/2 - 1 Mile Lower 66460AQUIFLOW Date: 07/26/1995 Average Water Depth: Not Reported Deep Water Depth: 8 Shallow Water Depth: 5 Groundwater Flow: SW Site ID: 083002920T5G ENE 1/2 - 1 Mile Lower 68233AQUIFLOW Date: 10/15/1997 Average Water Depth: Not Reported Deep Water Depth: 6.92 Shallow Water Depth: 3.12 Groundwater Flow: SW Site ID: 083002183T4G NNW 1/2 - 1 Mile Lower 68189AQUIFLOW Date: 09/04/1992 Average Water Depth: 10 Deep Water Depth: Not Reported Shallow Water Depth: Not Reported Groundwater Flow: Varies Site ID: 083001957T3G NNW 1/2 - 1 Mile Lower 68214AQUIFLOW Map ID Direction Distance Elevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC5646263.2s Page A-37 Not ReportedNot ReportedNot ReportedNot ReportedBasement Not ReportedNot ReportedNot ReportedNot ReportedLiving Area - 2nd Floor 0%0%100%0.763 pCi/LLiving Area - 1st Floor % >20 pCi/L% 4-20 pCi/L% <4 pCi/LAverage ActivityArea Number of sites tested: 30 Federal Area Radon Information for ORANGE COUNTY, CA : Zone 3 indoor average level < 2 pCi/L. : Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L. Note: Zone 1 indoor average level > 4 pCi/L. Federal EPA Radon Zone for ORANGE County: 3 03490720 ______________________ > 4 pCi/LNum TestsZipcode Radon Test Results State Database: CA Radon AREA RADON INFORMATION GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADON ® TOPOGRAPHIC INFORMATION USGS 7.5’ Digital Elevation Model (DEM) Source: United States Geologic Survey EDR acquired the USGS 7.5’ Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data with consistent elevation units and projection. Current USGS 7.5 Minute Topographic Map Source: U.S. Geological Survey HYDROLOGIC INFORMATION Flood Zone Data: This data was obtained from the Federal Emergency Management Agency (FEMA). It depicts 100-year and 500-year flood zones as defined by FEMA. It includes the National Flood Hazard Layer (NFHL) which incorporates Flood Insurance Rate Map (FIRM) data and Q3 data from FEMA in areas not covered by NFHL. Source: FEMA Telephone: 877-336-2627 Date of Government Version: 2003, 2015 NWI: National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002, 2005 and 2010 from the U.S. Fish and Wildlife Service. State Wetlands Data: Wetland Inventory Source: Department of Fish and Wildlife Telephone: 916-445-0411 HYDROGEOLOGIC INFORMATION AQUIFLOW Information SystemR Source: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table information. GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994). STATSGO: State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Service (NRCS) The U.S. Department of Agriculture’s (USDA) Natural Resources Conservation Service (NRCS) leads the national Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps. SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Service (NRCS) Telephone: 800-672-5559 SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Service, mapping scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the original soil survey maps. This level of mapping is designed for use by landowners, townships and county natural resource planning and management. TC5646263.2s Page PSGR-1 PHYSICAL SETTING SOURCE RECORDS SEARCHED LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLS PWS: Public Water Systems Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources. PWS ENF: Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS). USGS Water Wells: USGS National Water Inventory System (NWIS) This database contains descriptive information on sites where the USGS collects or has collected data on surface water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater. STATE RECORDS Water Well Database Source: Department of Water Resources Telephone: 916-651-9648 California Drinking Water Quality Database Source: Department of Public Health Telephone: 916-324-2319 The database includes all drinking water compliance and special studies monitoring for the state of California since 1984. It consists of over 3,200,000 individual analyses along with well and water system information. OTHER STATE DATABASE INFORMATION California Oil and Gas Well Locations Source: Department of Conservation Telephone: 916-323-1779 Oil and Gas well locations in the state. California Earthquake Fault Lines Source: California Division of Mines and Geology The fault lines displayed on EDR’s Topographic map are digitized quaternary fault lines prepared in 1975 by the United State Geological Survey. Additional information (also from 1975) regarding activity at specific fault lines comes from California’s Preliminary Fault Activity Map prepared by the California Division of Mines and Geology. RADON State Database: CA Radon Source: Department of Public Health Telephone: 916-210-8558 Radon Database for California Area Radon Information Source: USGS Telephone: 703-356-4020 The National Radon Database has been developed by the U.S. Environmental Protection Agency (USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey. The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at private sources such as universities and research institutions. TC5646263.2s Page PSGR-2 PHYSICAL SETTING SOURCE RECORDS SEARCHED EPA Radon Zones Source: EPA Telephone: 703-356-4020 Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor radon levels. OTHER Airport Landing Facilities: Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656 Epicenters: World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration California Earthquake Fault Lines: The fault lines displayed on EDR’s Topographic map are digitized quaternary fault lines, prepared in 1975 by the United State Geological Survey. Additional information (also from 1975) regarding activity at specific fault lines comes from California’s Preliminary Fault Activity Map prepared by the California Division of Mines and Geology. STREET AND ADDRESS INFORMATION © 2015 TomTom North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material. TC5646263.2s Page PSGR-3 PHYSICAL SETTING SOURCE RECORDS SEARCHED Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX E Previous Phase I ESA Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX F Historical Aerial Photographs The EDR Aerial Photo Decade Package Not Reported Not Reported Los Alamitos, CA 90720 Inquiry Number: May 09, 2019 5646263.8 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com 2016 1"=500'Flight Year: 2016 USDA/NAIP 2012 1"=500'Flight Year: 2012 USDA/NAIP 2009 1"=500'Flight Year: 2009 USDA/NAIP 2005 1"=500'Flight Year: 2005 USDA/NAIP 1994 1"=500'Acquisition Date: June 01, 1994 USGS/DOQQ 1990 1"=500'Flight Date: September 06, 1990 USDA 1989 1"=500'Flight Date: August 22, 1989 USDA 1981 1"=500'Flight Date: February 21, 1981 EDR Proprietary Brewster Pacific 1977 1"=500'Flight Date: January 18, 1977 EDR Proprietary Brewster Pacific 1970 1"=500'Flight Date: February 19, 1970 EDR Proprietary Brewster Pacific 1963 1"=500'Flight Date: February 28, 1963 USGS 1952 1"=500'Flight Date: November 18, 1952 USDA 1947 1"=500'Flight Date: June 17, 1947 FAIR 1938 1"=500'Flight Date: June 21, 1938 USDA 1928 1"=500'Flight Date: January 01, 1928 FAIR EDR Aerial Photo Decade Package 05/09/19 Not Reported Site Name:Client Name: Roux Associates Not Reported 402 Heron Drive Los Alamitos, CA 90720 Logan Township, NJ 08085-0000 EDR Inquiry #5646263.8 Contact:Angela Truong Environmental Data Resources, Inc. (EDR) Aerial Photo Decade Package is a screening tool designed to assist environmental professionals in evaluating potential liability on a target property resulting from past activities. EDR’s professional researchers provide digitally reproduced historical aerial photographs, and when available, provide one photo per decade. Search Results: Year Scale Details Source When delivered electronically by EDR, the aerial photo images included with this report are for ONE TIME USE ONLY. Further reproduction of these aerial photo images is prohibited without permission from EDR. For more information contact your EDR Account Executive. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2019 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. 5646263 8-page 2 5646263.8 2016 = 500' 5646263.8 2012 = 500' 5646263.8 2009 = 500' 5646263.8 2005 = 500' 5646263.8 1994 = 500' 5646263.8 1990 = 500' 5646263.8 1989 = 500' 5646263.8 1981 = 500' 5646263.8 1977 = 500' 5646263.8 1970 = 500' 5646263.8 1963 = 500' 5646263.8 1952 = 500' 5646263.8 1947 = 500' 5646263.8 1938 = 500' 5646263.8 1928 = 500' Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX G City Directories Not Reported Not Reported Los Alamitos, CA 90720 Inquiry Number: 5646263.5 May 13, 2019 The EDR-City Directory Image Report 6 Armstrong Road Shelton, CT 06484 800.352.0050 www.edrnet.comEnvironmental Data Resources IncEnvironmental Data Resources IncEnvironmental Data Resources IncEnvironmental Data Resources Inc TABLE OF CONTENTS SECTION Executive Summary Findings City Directory Images Thank you for your business. Please contact EDR at 1-800-352-0050 with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OR DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction orforecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2017 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc. or its affiliates is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. EXECUTIVE SUMMARY DESCRIPTION Environmental Data Resources, Inc.’s (EDR) City Directory Report is a screening tool designed to assist environmental professionals in evaluating potential liability on a target property resulting from past activities. EDR’s City Directory Report includes a search of available city directory data at 5 year intervals. RECORD SOURCES EDR's Digital Archive combines historical directory listings from sources such as Cole Information and Dun & Bradstreet. These standard sources of property information complement and enhance each other to provide a more comprehensive report. EDR is licensed to reproduce certain City Directory works by the copyright holders of those works. The purchaser of this EDR City Directory Report may include it in report(s) delivered to a customer. Reproduction of City Directories without permission of the publisher or licensed vendor may be a violation of copyright. RESEARCH SUMMARY The following research sources were consulted in the preparation of this report. A check mark indicates where information was identified in the source and provided in this report. Year Target Street Cross Street Source 2014 þ ¨EDR Digital Archive 2010 þ ¨EDR Digital Archive 2005 þ ¨EDR Digital Archive 2000 þ ¨EDR Digital Archive 1995 þ ¨EDR Digital Archive 1992 þ ¨EDR Digital Archive 1985 þ ¨Haines Criss-Cross Directory 1980 þ ¨Haines Criss-Cross Directory 1975 þ ¨Haines Criss-Cross Directory 1972 þ ¨Haines Criss-Cross Directory 1971 þ ¨Haines Criss-Cross Directory 1966 þ ¨General Telephone Co 5646263-5 Page 1 FINDINGS TARGET PROPERTY STREET Not Reported Los Alamitos, CA 90720 Year CD Image Source KATELLA AVE 2014 pg A2 EDR Digital Archive 2010 pg A4 EDR Digital Archive 2005 pg A6 EDR Digital Archive 2000 pg A8 EDR Digital Archive 1995 pg A10 EDR Digital Archive 1992 pg A12 EDR Digital Archive 1985 pg A13 Haines Criss-Cross Directory 1985 pg A14 Haines Criss-Cross Directory 1985 pg A15 Haines Criss-Cross Directory 1980 pg A16 Haines Criss-Cross Directory 1980 pg A17 Haines Criss-Cross Directory 1975 pg A18 Haines Criss-Cross Directory 1975 pg A19 Haines Criss-Cross Directory 1972 pg A20 Haines Criss-Cross Directory 1971 pg A21 Haines Criss-Cross Directory 1971 pg A22 Haines Criss-Cross Directory 1966 pg A23 General Telephone Co 5646263-5 Page 2 FINDINGS CROSS STREETS No Cross Streets Identified 5646263-5 Page 3 City Directory Images - KATELLA AVE EDR Digital Archive 5646263.5 Page: A2 SourceTarget Street Cross Street 2014 4921 RACE TRACK CHAPLAINCY SEVENTH DAY ADVENTIST CHURCH THREESXTYFIVE STDNT MINISTRIES 4931 MARRIOTT INTERNATIONAL INC 4951 24 HOUR FITNESS USA INC 4955 OFFICE DEPOT INC 4957 COLD STONE CREAMERY PACIFIC PREMIER BANK ROCKSTAR TAN LLC 4959 AROMA ITALIANO CAFE CYPRESS SUBWAY JV BEAUTY SYSTEMS INC JV CRTIVE NILS SPA CNCEPTS LLC LA SALSA FRESH MEXICAN GRILL WHITE SANDS SALON & DAY SPA 4961 BURLINGTON HOLDINGS LLC CALIFRNIA JOCKEYS WELFARE CORP CAPTIVE DEVELOPMENT INC COOPER JOHN EDWARD C ALLRED FOUNDATION HORSE RACING BOARD CALIFORNIA LOS ALAMITOS RACE COURSE LOS ALAMITOS RACING ASSN PACIFIC COAST QRTER HORSE RCNG PEGASUS COMMUNICATIONS INC QUARTER HORSE RACING INC T&R TACK & SUPPLY WEHRLWIND MEDIA 5008 CLASSIC BURGER CAFE KATELLA GARDEN INC NIKOLAU ENTERPRISES INC 5010 FINAL TOUCH ELECTROLOGY CLINIC 5018 HEALING STORM A MARTINEZ JOHN 5024 CALIFORNIA TACK FOX FOX FOX TRAVEL PFD ACADEMY QUARTER HRSE BENVLNT CHRTY FND SUMMIT LENDING 5028 CHAMBERLAIN THOMAS A DDS 5030 ACTION LEGAL NETWORK ADAM INTELLIGENT TRAVEL SVC BBC IMPORTS LLC BOB MAW CAR WASH BROKER CLEARWATER MANAGEMENT SERVICES COMPANION CARE SERVICES DEW, OLIVER J ELSAHHAR ASHRAF GORYL GERARD MD (Cont'd) - KATELLA AVE EDR Digital Archive 5646263.5 Page: A3 SourceTarget Street Cross Street 2014 5030 INNOVATION SOLUTIONS INC LAW OFFICES SUSAN REGEIMBAL MANUFACTURING PROS LLC PETS CENTRAL EXPRESS PHARMACY REALITY HOUSE INC STANYO DAVID P UNITED RUBBER WKRS LOCAL 560 UNITED STEELWORKERS 560L LOCAL - KATELLA AVE EDR Digital Archive 5646263.5 Page: A4 SourceTarget Street Cross Street 2010 4921 SEVENTH DAY ADVENTIST CHURCH 4931 MARRIOTT INTERNATIONAL INC 4951 24 HOUR FITNESS USA INC 4955 OFFICE DEPOT INC STEFAN BEAN 4957 COLD STONE CREAMERY CYNERGY INC PACIFIC PREMIER BANK 4959 CYPRESS SUBWAY JOO SON CORP JV BEAUTY SYSTEMS INC JV CRTIVE NILS SPA CNCEPTS LLC LA SALSA FRESH MEXICAN GRILL RAHE ENTERPRISES INC WHITE SANDS SALON & DAY SPA 4961 BAZELY TOM RACING STABLE BURLINGTON HOLDINGS LLC CALIFRNIA JOCKEYS WELFARE CORP CAPTIVE DEVELOPMENT INC COOPER JOHN EDWARD C ALLRED FOUNDATION FINISH LINE SELF INSURANCE GRP HALL CONNIE RACING STABLE HOBSONS SADDLERY HORSE RACING BOARD CALIFORNIA LEWIS EQUINE MANAGEMENT SERVIC LOS ALAMITOS RACE COURSE LOS ALAMITOS RACE TRACK LOS ALAMITOS RACING ASSN MCARTHUR RACING STABLES PACIFIC COAST QRTER HORSE RCNG PEGASUS COMMUNICATIONS INC QUARTER HORSE RACING INC SAN VICENTE HOSPITAL CORP SCOTWINC T&R TACK & SUPPLY WEHRLWIND MEDIA 5008 CLASSIC BURGER CAFE KATELLA GARDEN INC NIKOLAU ENTERPRISES INC 5010 FINAL TOUCH ELECTROLOGY CLINIC LASTING IMAGES 5014 GRAIN RESOURCE INC TELESIS NETWORK INC 5018 HEALING STORM A MARTINEZ JOHN 5020 MAX MUSCLE 5024 A & P DRYWALL AMERITEC INTERNATIONAL INC BRIDESHEAD LLC (Cont'd) - KATELLA AVE EDR Digital Archive 5646263.5 Page: A5 SourceTarget Street Cross Street 2010 5024 CALIFORNIA TACK COASTAL INVESTMENT NETWORK DAN S ELECTRICAL SERVICE DAVISOLUTIONS PFD ACADEMY POST TIME INC PREPARING FOR A DEGREE INC PULAU ELECTRONICS QUARTER HRSE BENVLNT CHRTY FND 5028 CHAMBERLAIN THOMAS A DDS 5030 ADAM INTELLIGENT TRAVEL SVC BTM CAR WASH BROKER CLEARWATER MANAGEMENT SERVICES COMPANION CARE SERVICES ELSAHHAR ASHRAF GABRIEL MICHELLE R LAW OFFICES GOLD COAST DIABETES RESOURCE GOMEZ LANDSCAPING GUGA TOURS INNOVATION SOLUTIONS INC INTELLIGENT TRAVEL & TOURS JOHN KRISTIANSON LAW OFFICES SUSAN REGEIMBAL MANUFACTURING PROS LLC MAW BOB INSURANCE PAYROLL PROS INC PERFECT RATE INSURANCE AGENCY STANYO DAVID P UNITED RUBBER WKRS LOCAL 560 UNITED STEELWORKERS 560L LOCAL - KATELLA AVE EDR Digital Archive 5646263.5 Page: A6 SourceTarget Street Cross Street 2005 4921 CYPRESS GC LLC F B D ENTERPRISES USA INC FJC USA INC 4931 MARRIOTT INTERNATIONAL INC 4951 24 HOUR FITNESS USA INC 24 HOUR FITNESS WORLDWIDE INC CAL SELECT BUILDERS INC VCC 4955 OFFICE DEPOT INC 4957 148 COFFEE BEAN & TEA LEAF 4959 ISLAND CLEANERS RED PERSIMMON NAIL & SPA WHITE SANDS SALON AND BASEBALL 4961 16835 ALGONQUIN CORPORATION ARABIAN RACING ASSOC OF CALI AUTOTOTE SYSTEMS INC BASSETT RACING BAZELY TOM RACING STABLE CALIFORNIA OUTDOOR MARKET INC COOPER JOHN DENNY EKINS RACING STABLE EG HIGH DESERT FARM GOLDEN HORSE SHOE KITCHEN HALL CONNIE RACING STABLE HOBSONS SADDLERY HORSE RACING BOARD CALIFORNIA HORSEMENS QRTER HRSE RACG ASSN L M DUNCAN RACING STABLES LOS ALAMITOS RACE COURSE LOS ALAMITOS RACE TRACK LOS ALAMITOS RACING ASSN MC ELECTRIC MCARTHUR RACING STABLES MO MO INC PACIFIC COAST QRTER HORSE RCNG PAYNES RACING ARABIANS PEGASUS COMMUNICATIONS INC QUARTER HORSE RACING INC SMITH VINCENT J T&R TACK & SUPPLY 5008 KATELLA GARDEN INC NIKOLAU ENTERPRISES INC PARK HOUSTON K SAINT PAULS PLACE 5010 FINAL TOUCH ELECTROLOGY CLINIC LASTING IMAGES 5014 ORANGE COUNTY PC SOLUTION 5018 ACU-MED ACUPUNCTURE 5020 JOHNSON FORM TOOL & EDM INC 5024 ALL PRO ELECTRIC (Cont'd) - KATELLA AVE EDR Digital Archive 5646263.5 Page: A7 SourceTarget Street Cross Street 2005 5024 CALIFORNIA TACK COASTAL INVESTMENT NETWORK DAVISOLUTIONS FURNITURE TRENDS WEST INC HART SECURITY LAWLER ROY MEDSERV TRANSCRIPTION PUB POST TIME INC PREPARING FOR A DEGREE INC QUARTER HORSE BENEVOLNT CHARTY SOUTHLAND DISTRIBUTION INC 5028 CHAMBERLAIN THOMAS A DDS CHAMBERLAIN THOMAS ARTHUR DDS TACHION INDUSTRIES 5030 A & A APPRAISALS INC A CREATIVE TOUCH ADAM INTELLIGENT TRAVEL SVC CAR WASH BROKER CITA PAYROLL CORRECTIONAL SYSTEMS INC GOLANTY LORRIEE M ATTY AT LAW GOMEZ LANDSCAPING GUGA TOURS I&M INSURANCE LAWLER, ROY LEAP ELIZABETH H MAMDOUH ABOUSHOLLSHA MAW BOB INSURANCE MAX MUSCLE OF LOS ALAMITOS MFG PROS LLC MYKONOS RESTAURANT PEPSI COLA FEDERAL CREDIT UN SATURN INSURANCE COMPANY SENTENCING CONCEPTS INC SHAW & WEITZ SHAW, JOHN R UNITED RUBBER WKRS LOCAL 560 VENEY, F VENTURA JIM - KATELLA AVE EDR Digital Archive 5646263.5 Page: A8 SourceTarget Street Cross Street 2000 4772 INVISION STUDIOS INC MINNA DAVID A MD R D H ASSOCIATES 4782 HUDZIETZ DON HUDZIETZ DON INCOME TAX SVC INCOME TAXES SERVICE RAY MICHAEL INCOME TAX & FIN 4784 WORTHINGTON & ASSOCIATES 4921 F B D ENTERPRISES USA INC FJC USA INC (DEL) FUJI COUNTRY USA INC 4951 MARK RUNNINGBEAR 4961 ARABIAN RACING ASSOC OF CALI AUTOTOTE SYSTEMS INC BRAITHWAITE BRYAN RACG STABLE CALIFORNIA TACK COMPURACE INC COOPER JOHN DENNY EKINS RACING STABLE HALL CONNIE RACING STABLE HOBSONS SADDLERY HORSE RACING BOARD CALIFORNIA HORSEMENS QUARTER HORSE LOS ALAMITOS QUARTER HRSE RACG LOS ALAMITOS RACE COURSE LOS ALAMITOS RACING ASSN MARKET PL AT LSLMTOS RACE CURS MASTERS BINE RACING STABLES MO MO INC PACIFIC COAST QRTER HORSE RCNG PAYNES RACING ARABIANS PEGASUS COMMUNICATIONS INC PENINSULA HORSE RACING ASSN QUARTER HORSE RACING INC T&R TACK & SUPPLY 5010 R AND W ELECTRONICS INC 5014 GARDNER MAXINE 5018 INDEPENDENT CONSULTANTS VOCAT MARTINEZ, JOHN 5020 SOPHISTS REGALIA 5024 CENTOS COMPANY CHUCK FIRST CHIMNEY SWEEPER DETAILS WORD DATA PROCESSING FREEMAN FURNITURE PREPARING FOR A DEGREE INC 5028 CHAMBERLAIN THOMAS A DDS 5030 COHEN, DOUGLAS A GARRISON, WILLIAM GOLANTY LORRIEE M ATTY AT LAW I&M INSURANCE (Cont'd) - KATELLA AVE EDR Digital Archive 5646263.5 Page: A9 SourceTarget Street Cross Street 2000 5030 IKNADOSIAN, RALPH N LEAP ELIZABETH H LEAP, E H MAW ROBERT C NELMS ROBERT L PEPSI COLA FEDERAL CREDIT UN PROFESSIONAL CHOICE INSUR SENTENCING CONCEPTS INC SHAW & WEITZ UNITED RUBBER WKRS LOCAL 560 WURTZ PAUL - KATELLA AVE EDR Digital Archive 5646263.5 Page: A10 SourceTarget Street Cross Street 1995 4772 EXPRESS SUPPORT SERVICES INC LAYTON, PHILIP D PACIFIC TECHNICAL SA R D H ASSOCIATES THELEN, P J WEST COAST INTERIORS 4782 DUNN, KELLY 4784 APPLING INSURANCE COMPANY APPLING INSURANCE SERVICES 4921 CYPRESS GOLF CLUB F B D ENTERPRISES USA INC FJC USA INC (DEL) FUJI COUNTRY USA INC 4961 AUTOTOTE SYSTEMS INC BLOOMQUIST CHARLES BLOOMQUIST, CHARLES BLUMENFELD PAUL RACING STABLES BOYCE MEL HORSE TRANSPORTATION GARRETT, DANNY GIVENS, DENNIS HORSEMENS QRTR HRS IRBY WILLIAM R IRBY, WILLIAM R JAIME, H LAYNE, BRET LOS ALAMITOS RACING ASSN PENINSULA HORSE RACING ASSN PICHES CRCORAN TRAINING STABLE PINELLI, LAURA POST TIME QUARTER HORSE RACING INC 5010 FAMILY SHOES SEWING BY SUSAN 5014 GARDNER RING CO 5018 MARTINEZ, JOHN 5020 R AND W ELECTRONICS 5024 AVERILL, JAMES BARRANTES, ANTHONY BOQUIST, LARRY BOYEE, MEL BRADLEY TRANSPORTATION CENTOS COMPANY CREATIVE HAIR DESIGN DAVIS, RAYMOND DIORIO, JAMES FREEMAN FURNITURE FRIESS, ANN GERVAIS, KAREN GLAVES, MELVIN GUZMAN, GUSTAVO C (Cont'd) - KATELLA AVE EDR Digital Archive 5646263.5 Page: A11 SourceTarget Street Cross Street 1995 5024 HAMMES, WENDY KANDELA, IMAD KURI, DAVID MICHENER, ARTHUR T MILLER, JOHN B PANGOLIBAY, WILLIE POST TIME MAIL CENTER PRINTING PRESS SHOEMAKER, CHERYL TURNER, PETER WEBB, PAUL WILSON, PENTICA F ZYLSTRA, JEAN 5030 BALLMAN, JOHN W DEWOLF GREGORY FEMMI GREEN ESCROW CORP GOLANTY LORRIEE M ATTY AT LAW GOLANTY, LORRIEE M LEAP ELIZABETH H EA NOTHWANG SALLY P NOTHWANG, SALLY P PEPSI COLA FEDERAL CREDIT UN ROBERT L NELMS SHAW & WEITZ SHAW, JOHN R UNITED RUBBER WKRS LOCAL 560 WEITZ, MARK S WURTZ, PAUL - KATELLA AVE EDR Digital Archive 5646263.5 Page: A12 SourceTarget Street Cross Street 1992 4772 ATTORNEY ASSISTED LEGAL CTRS EXPRESS SUPPORT SERVICES INC LAYTON PHIL LAYTON, PHILIP D R D H ASSOCIATES THELEN, P J 4782 DUNN KELLY & ASSOCIATES 4784 APPLING INSURANCE CO 4921 FJC USA INC (DEL) 4961 AMTOTE INTERNATIONAL INC BOYCE MEL HORSE TRANSPORTATION DOMINGUEZ CAESAR RACG STABLES HORSEMENS QRTR HRS LOS ALAMITOS COUNTRY CLUB LOS ALAMITOS RACING ASSN PENINSULA HORSE RACING ASSN POST TIME QUARTER HORSE RACING INC SOUTHERN CALIFORNIA 5008 MR GS HAMBURGERS 5010 FAMILY SHOES NEWCOMB JANET A 5018 BROOKLIER, SUSIE CREATIVE HAIR DESIGN MARTINEZ, JOHN PHIL SINGER INTERNATIONAL INC 5024 CREATIVE TRADING INC ELECTRA TEK INC PRINTING PRESS 5028 SOUND SOLUTIONS 5030 DECOR FLOORING AND RESTORATION DEWOLF GREGORY GOLANTY LORRIEE GREEN FEMMI ESCROW INC GREER & MATHIEU INC KRUSE INSURANCE NOTHWANG SALLY P PEPSI COLA CREDIT UNION PETERSON & ROSS - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A13 SourceTarget Street Cross Street 1985 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A14 SourceTarget Street Cross Street 1985 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A15 SourceTarget Street Cross Street 1985 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A16 SourceTarget Street Cross Street 1980 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A17 SourceTarget Street Cross Street 1980 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A18 SourceTarget Street Cross Street 1975 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A19 SourceTarget Street Cross Street 1975 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A20 SourceTarget Street Cross Street 1972 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A21 SourceTarget Street Cross Street 1971 - KATELLA AVE Haines Criss-Cross Directory 5646263.5 Page: A22 SourceTarget Street Cross Street 1971 - KATELLA AVE General Telephone Co 5646263.5 Page: A23 SourceTarget Street Cross Street 1966 Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX H Sanborn Fire Maps Certified Sanborn® Map Report Inquiry Number: 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com Not Reported Not Reported Los Alamitos, CA 90720 May 08, 2019 5646263.3 Certified Sanborn® Map Report Certified Sanborn Results: Disclaimer - Copyright and Trademark Notice EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. page- The Sanborn Library includes more than 1.2 million fire insurance maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow and others which track historical property usage in approximately 12,000 American cities and towns. Collections searched: Library of Congress University Publications of America EDR Private Collection The Sanborn Library LLC Since 1866™ Limited Permission To Make Copies Sanborn® Library search results Contact:EDR Inquiry # Site Name: Client Name: Certification # PO # Project 05/08/19 Not Reported Not Reported Roux Associates 402 Heron Drive Los Alamitos, CA 90720 5646263.3 Logan Township, NJ 08085-0000 Angela Truong The Sanborn Library has been searched by EDR and maps covering the target property location as provided by Roux Associates were identified for the years listed below. The Sanborn Library is the largest, most complete collection of fire insurance maps. The collection includes maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow, and others. Only Environmental Data Resources Inc. (EDR) is authorized to grant rights for commercial reproduction of maps by the Sanborn Library LLC, the copyright holder for the collection. Results can be authenticated by visiting www.edrnet.com/sanborn. The Sanborn Library is continually enhanced with newly identified map archives. This report accesses all maps in the collection as of the day this report was generated. 3B52-4B28-9B2A 2217.0014L000 UNMAPPED PROPERTY Cypress This report certifies that the complete holdings of the Sanborn Library, LLC collection have been searched based on client supplied target property information, and fire insurance maps covering the target property were not found. Certification #: 3B52-4B28-9B2A Roux Associates (the client) is permitted to make up to FIVE photocopies of this Sanborn Map transmittal and each fire insurance map accompanying this report solely for the limited use of its customer. No one other than the client is authorized to make copies. Upon request made directly to an EDR Account Executive, the client may be permitted to make a limited number of additional photocopies. This permission is conditioned upon compliance by the client, its customer and their agents with EDR's copyright policy; a copy of which is available upon request. This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2019 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. 5646263 3 2 Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX I Regulatory Records Documentation 1 Mark Edwards From:OCSD Records and Info Portal <ocsd@mycusthelp.net> Sent:Wednesday, May 8, 2019 2:12 PM To:atruong@ Subject:Public Records Request :: P000881-050819 This message originated outside your organization. Please use caution!     ‐‐‐ Please respond above this line ‐‐‐ Dear Angela, The Orange County Sanitation District (OCSD) has completed its review of your May 08, 2019 Public Records Request. Request Description: “Hello, We are conducting a Phase I Environmental Site Assessment at a property in City of Cypress. There is no address associated with the property. We are interested in obtaining documents related to the APNs: • 241-091-22 • 241-091-23 • 241-091-24 • 241-091-25 • 241-091-26 Can you please notify us if you have any records? Thank you.” Request Determination: OCSD has reviewed its files and has determined that there are no responsive records associated with this request. If you have any questions regarding this request you may send a message via your Request Portal account or contact us directly at (714) 593-7050. Sincerely, Jana Gutierrez Orange County Sanitation District     Please log in to review.  2 To monitor the progress or update this request please log into the Public Records and Information Center.      To help protect your privacy, Microsoft Office prevented automatic download of this picture from the Internet.   1 Mark Edwards From:Orange County Public Records <orangecounty@public-records-requests.com> Sent:Friday, May 10, 2019 9:03 AM To:Angela Truong Subject:[External Message Added] Orange County public records request #19-1378 This message originated outside your organization. Please use caution! -- Attach a non-image file and/or reply ABOVE THIS LINE with a message, and it will be sent to staff on this request. -- Orange County Public Records Hi there A message was sent to you regarding record request #19-1378: This is in response to your California Public Records Act request 19-1378, which OC Waste & Recycling received on May 8, 2019. The request seeks the following records: "We are interested in obtaining documents related to the APNs: 241-091-22; 241-091-23; 241-091-24; 241-091-25; 241-091-26" OC Waste & Recycling is not in possession of records responsive to your request. You may contact the Orange County Health Care Agency, which may have responsive records related to your request. Here is contact information for the HCA custodian of records: (714) 834-3536 of COR@ochca.com With this response, we consider your PRA request to OC Waste & Recycling closed. Best regards, 2 Ruth Wardwell View Request 19-1378 http://orangecounty.nextrequest.com/requests/19-1378 To help prprivacy, Mprevented download from the In POWERED BY NEXTREQUEST The All in One Records Requests Platform Questions about your request? Reply to this email or sign in to contact staff at Orange County. Technical support: See our help page 1 Mark Edwards From:Orange County Public Records <orangecounty@public-records-requests.com> Sent:Wednesday, May 8, 2019 2:24 PM To:Angela Truong Subject:[External Message Added] Orange County public records request #19-1377 This message originated outside your organization. Please use caution! -- Attach a non-image file and/or reply ABOVE THIS LINE with a message, and it will be sent to staff on this request. -- Orange County Public Records Hi there A message was sent to you regarding record request #19-1377: This is in response to your California Public Records Act request. We are unable to process your request at this time. In order to fulfill your request Please provide specific address(s) we do not do research using APN's Please submit the form located at http://www.ochealthinfo.com/eh/contact/request If you have any questions please call this office at (714) 433- 6015. View Request 19-1377 http://orangecounty.nextrequest.com/requests/19-1377 2 To help protect your privacy, Microsoft Office prevented automatic download of this picture from the Internet. POWERED BY NEXTREQUEST The All in One Records Requests Platform Questions about your request? Reply to this email or sign in to contact staff at Orange County. Technical support: See our help page Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX J Photographic Log Page 1 of 10 2217.00014L.100/R             J-1. Looking west from the southwest corner of the Site (5/13/2019). J-2. Looking southwest across Katella Avenue from the southwest corner of the Site (5/13/2019). Page 2 of 10 2217.00014L.100/R             J-3. Looking east down Katella Avenue from the southwest corner of the Site (5/13/2019). J-4. Looking west from the southeast corner of the Site along berm feature (5/13/2019). Page 3 of 10 2217.00014L.100/R             J-5. Looking north from the eastern edge of the Site along Winners Circle (5/13/2019). J-6. Looking west across the Site toward the adjacent Costco facility; unpaved surface with apparent base fill visible in foreground (5/13/2019). Page 4 of 10 2217.00014L.100/R             J-7. Looking south along the eastern edge of the Site; elevation difference between Site and Winners Circle is visible (5/13/2019). J-8. Looking north from the northern edge of the Site toward the adjacent parking lot (5/13/2019). Page 5 of 10 2217.00014L.100/R               J-9. Looking northwest from the northwest corner of the Site (5/13/2019). J-10. Looking south along the western edge of the Site with de minimis staining visible in foreground (5/13/2019). Page 6 of 10 2217.00014L.100/R                J-11. Western adjacent retail businesses (5/13/2019). J-12. Looking north across Site, with apparent boring location marked on pavement (5/13/2019). J-11. Western adjacent retail businesses (5/13/2019). Page 7 of 10 2217.00014L.100/R          J-13. Looking south across Site, with drainage swale visible in foreground and parked trucks visible in background (5/13/2019). J-14. Looking southeast across unpaved portion of Site (5/13/2019). Page 8 of 10 2217.00014L.100/R          J-15. Truck parking area of Site with recently patched boring visible in foreground (5/13/2019). J-16. Looking north across Site, with geotechnical drilling operations visible (5/13/2019). Page 9 of 10 2217.00014L.100/R          J-17. Transformer located in southwest portion of Site; transformer label indicates manufacturing date of January 2010 (5/13/2019). J-18. Ponding liquid presumed to be irrigation water in the southwest portion of the Site (5/13/2019). Page 10 of 10 2217.00014L.100/R            J-19. One of two drainage areas observed in the southern portion of Site (5/13/2019). J-20. Cover of subsurface pipe labeled "LASCO PVC 8" " in southern portion of Site (5/13/2019). Phase I Environmental Site Assessment and Limited Phase II Soil Investigation NW Corner Katella Avenue and Winners Circle, Cypress, California 2217.0014L.100/R Phase I ESA | ROUX APPENDIX K Personnel Qualifications 10/2018 5150 East Pacific Coast Highway, Suite 450 | Long Beach, CA 90804 1 of 4 Main: 310-879-4900 | Direct: 310-879-4920 E-mail: mescobar@rouxinc.com | Website: www.rouxinc.com Mauricio H. Escobar, P.G. Principal Geologist PROFESSIONAL PROFILE TECHNICAL SPECIALTIES Professional Geologist with over twenty years of experience designing, managing, and implementing environmental soil and groundwater investigations and remediation strategies for public and private clients. Experience as in-house consultant assisting with management of a $25MM yearly remediation portfolio for a Fortune 100 Company. Practice developing and implementing high-level strategies that consider legal and regulatory issues, communications and government relations, as well as technical challenges and costs. Significant assignments representing clients during Working Group meetings for Superfund sites and participation in technical committee meetings. Expertise in design and field implementation of in-situ chemical oxidation (ISCO) in hard rock and porous media-flow aquifers. Substantial experience evaluating and remediating industrial, commercial and residential sites impacted with numerous contaminants in multiple media, including crude oil, fuels, volatile organic compounds, chromium VI, 1,4-dioxane, and PCBs. Extensive experience managing implementation of remediation programs that utilize and consider multiple technologies including soil vapor extraction, dual phase extraction, traditional pump and treat, in-well stripping, air sparging, chemical oxidation and reduction, thermal treatment, and natural attenuation. Experience managing large-scale remedial excavations involving the use of heavy earth moving equipment. Significant field experience using numerous drilling, soil sampling, groundwater sampling, and soil vapor sampling techniques. EXPERIENCE SUMMARY 21 years of consulting experience: Principal Geologist with Roux Associates (2011 to Present); Senior Manager, Manager, and Senior Associate with ENVIRON International Corporation (2004 to 2011); Project Geologist with URS Corporation (2001 to 2004); Geologist with Hart Crowser (1998 to 2001). CREDENTIALS Bachelor of Arts, Earth Science, 1995 University of California, Berkeley Professional Geologist, State of California, No. 07506 OSHA 40-Hour Hazardous Waste Operations and Emergency Response (HAZWOPER) Certified Research Assistant to UC Berkeley Ph.D. Candidate Dawnika L. Blatter and Professor Ian S. E. Carmichael in Study of Continental Crustal Deformation from Subduction of the Cocos Plate in Western Mexico and Study of Upper Mantle Petrology in Central Mexico, January to April 1996 CONTINUING EDUCATION Compounds of Emerging Concern in Groundwater, California Groundwater Resources Association, Concord, California, February 2012 The Remediation Course, Princeton Groundwater, Las Vegas, Nevada, April 2010 Vapor Intrusion Pathway: A Practical Guideline, Interstate Technology and Regulatory Council (ITRC) in conjunction with the California Department of Toxic Substances (DTSC) and California Water Boards, Long Beach, California, June 2009 The Groundwater Pollution and Hydrology Course, Princeton Groundwater, Orlando, Florida, February 2007 Hydrogeologic Analysis of Fractured Bedrock Systems, Midwest GeoSciences Group, University of Nevada Las Vegas and Nevada Test Site at Yucca Mountain, March 2006 TECHNICAL PRESENTATIONS Prevalence and Persistence of Hexavalent Chromium During In-Situ Chemical Oxidation of Trichloroethylene with Permanganate, Antony D. G. Jones and Carol L. Serlin, ENVIRON, Irvine, CA; Mauricio H. Escobar, ENVIRON, Los Angeles, CA; George D. Havalias and Maria C. Echarte, American Analytics, Inc., Chatsworth, CA. The 19th Annual AEHS Meeting and West Coast Conference on Soils, Sediments, & Water, San Diego, California, March 2009 Assessment of Microbial Community Composition Throughout In-Situ Chemical Oxidation of Trichloroethylene with Permanganate, Bram Sercu and Patricia Holden, UCSB, Santa Barbara, CA; Antony D. G. Jones and Carol L. Serlin, ENVIRON, Irvine, CA; Mauricio H. Escobar, ENVIRON, Los Angeles, CA. The 19th Annual AEHS Meeting and West Coast Conference on Soils, Sediments, & Water, San Diego, California, March 2009 Evaluation of the Effects of ISCO on TCE Impacted Ground Water in Weathered Granitic Mass, Mauricio H. Escobar, ENVIRON, Los Angeles, CA; Antony D. G. Jones and Carol L. Serlin, ENVIRON, Irvine, CA. The 6th International Conference on Oxidation and Reduction Technologies for In-Situ Treatment of Soil and Groundwater, San Diego, California, September 2008 Assessing Sources of Hexavalent Chromium during In-Situ Chemical Oxidation of Trichloroethylene with Permanganate, Antony D. G. Jones and Carol L. Serlin, ENVIRON, Irvine, CA; Mauricio H. Escobar, ENVIRON, Los Angeles, CA. The 6th International Conference on Oxidation and Reduction Technologies for In-Situ Treatment of Soil and Groundwater, San Diego, California, September 2008 Aggressive DNAPL Remedial Program Replaces Conventional Methods and Facilitates Property Transaction, Mauricio H. Escobar, Bita Tabatabai, and Douglas Jones, ENVIRON, Irvine, CA. The 4th International Conference on Oxidation and Reduction Technologies for In-Situ Treatment of Soil and Groundwater, Chicago, Illinois, October 2005 10/2018 5150 East Pacific Coast Highway, Suite 450 | Long Beach, CA 90804 2 of 4 Main: 310-879-4900 | Direct: 310-879-4920 E-mail: mescobar@rouxinc.com | Website: www.rouxinc.com Mauricio H. Escobar, P.G. Principal Geologist PROFESSIONAL PROFILE KEY PROJECTS • PRP Representation of Fortune 100 Company, Omega Chemical Superfund Site, Whittier, California Provide ongoing technical consulting to a Fortune 100 Company and major PRP at the Omega Chemical Superfund Site in Whittier, California. Active participant of the Omega PRP Group (OPOG) Technical Committee. Attend all pertinent technical meetings and provide Client with technical and strategic input that protects their best interests. Maintain constant interaction with the legal and finance teams as necessary to ensure the technical and legal strategies are in agreement and that adequate funding is reserved well in advance of regulatory commitments and OPOG cash calls. Pertinent technical issues include soil gas and vapor intrusion, and a regional groundwater plume. Regulatory oversight is provided by USEPA Region IX. • PRP Representation of Fortune 100 Company, BKK Corporation Class I Landfill Organized Group, West Covina, California Provide ongoing technical consulting to a Fortune 100 Company at the former BKK Corporation Class I Landfill site in West Covina, California. Participant in the BKK Technical Committee and attendant of pertinent technical meetings. Maintain constant communication with the Client’s legal and finance teams and responsible for informing Client on the direction the Organized Group is headed. Responsible for identifying financial commitments made as part of technical decisions. Trusted with voicing opinions, concerns, and/or offering direction to the Group (if and when necessary), to ensure the Organized Group’s direction is consistent with the Client’s strategy. Pertinent technical issues include upgrades to the landfill infrastructure and groundwater remedial investigations in and around the landfill prism. Regulatory oversight is provided by the Department of Toxic Substances Control. • Portfolio Project Control – Fortune 100 Company, Torrance, CA Three years of experience working as a full-time in-house consultant for a Fortune 100 Company assisting with management of all aspects of a complex multi-site portfolio. General role included communication with alliance partners, vendors, corporate finance, attorneys, public relations/communications, and procurement to track and facilitate progress of 9 major projects ($400,000 to $1 MM/year) and 3 mega projects ($3MM to $10MM+/year) that were unique in nature and complexity. Portfolio included former chemical sites, landfills, aerospace facilities, and other heavy use industrial facilities that were undergoing State and RCRA closure, as well as sites under CERCLA Superfund actions with PRP commitments. Charged with helping to develop, evaluate, and refine remedial strategies and lifecycle costs for sites that utilized various cleanup technologies such as application of oxidants and reducing agents, thermal oxidation, groundwater pump and treat, dual-phase and 2- PHASE™ extraction, soil vapor extraction, air sparging, and in-well air stripping. Major role included verifying adequate funding and maintaining documentation consistent with Sarbanes Oxley. • Strategy Expert Consulting – Fortune 100 Company, Los Angeles, CA Ongoing third-party technical and strategic support to a Fortune 100 company for a major project involving former bulk storage and distribution facilities converted to open public space and residential uses. Site is undergoing remedial investigations and remedial alternatives evaluations under heavy regulatory and public scrutiny. Charged with providing opinions and recommendations as to the direction the current consultant and the regulatory agencies want to take the project and evaluating the conceptual site model and long term technical strategy. Active participant on technical team calls and ongoing direct communications with internal legal team. • Shipyard Decommissioning – Subsurface Assessment, Remedial Investigation, Demolition and Closure, Campbell Shipyard – Marco, Port of San Diego, California. Lead geologist in the preparation of a comprehensive subsurface study of the former Campbell Shipyard property at the Port of San Diego, California. Over 200 borings were necessary to delineate the extent of impacted soils. Relevant environmental issues included a former coal works gasification plant immediately adjacent to the Site, a 2 to 4-foot thick lens of polynuclear aromatic hydrocarbon (PAH) laden sediment present throughout the Site below the water table, a former on-site diesel and kerosene tank farm, and numerous leaking fuel USTs. Responsibilities also included management of shipyard abandonment activities, such as abatement of asbestos and lead-based paint containing materials, demolition of on- site structures, crushing of asphalt and concrete into Class II base, and a comprehensive geophysical survey to locate all on-site utilities and buried structures. The work was performed under the regulatory oversight of the San Diego Regional Water Quality Control Board and the San Diego Unified Port District. Total cost of the work was approximately $1.3MM, implemented over a 15 month period. • Neutral Third Party Oversight of Remediation Work, ITT Corporation and Home Depot, Glendale, California. Provided third party oversight for a site undergoing major remediation of VOCs and chromium VI in soils and 10/2018 5150 East Pacific Coast Highway, Suite 450 | Long Beach, CA 90804 3 of 4 Main: 310-879-4900 | Direct: 310-879-4920 E-mail: mescobar@rouxinc.com | Website: www.rouxinc.com Mauricio H. Escobar, P.G. Principal Geologist PROFESSIONAL PROFILE groundwater. The site was a former electronics manufacturing facility redeveloped as a major box retailer in Glendale, California. Services were provided on behalf of the former facility owners/operators and the current property owners, both of whom had differing interests and views on the remedial work being performed. Viewed all fieldwork and construction of remediation systems and attended quarterly meetings with consultants, attorneys, and clients to gauge progress, discuss ongoing work, and evaluate projected schedules for completion of remediation. Technical challenges to remediation included dewatering of 20-foot thick perched zone impacted with VOC contamination, despite a leaking slurry wall originally designed to prevent onsite migration from upgradient sources. • ISCO Demonstration Plan Using Permanganate, Wyle Laboratories, Riverside County, California. Designed, managed, and implemented an ISCO Demonstration Plan using sodium permanganate injection at a former industrial manufacturing facility in Southern California. Main goals of the application were to demonstrate effective oxidation of trichloroethene (TCE) in alluvium and fractured granitic bedrock, evaluate potential mobilization of naturally occurring reduced metals, and evaluate the potential application of ISCO at other areas of the Site, including off-site beneath residential homes. Twelve thousand gallons of 10% permanganate solution were delivered to the subsurface through 47 multi- depth permanent injection probes over a 22 day field event. TCE concentrations were reduced from a maximum of 30,000 microgram per liter (µg/L) to non-detect at the source area. Significantly, elevated hexavalent chromium [Cr(VI)] concentrations were observed in the area of injection and immediately downgradient. Following field observations, a Bench Scale Assessment (BSA) was conducted to evaluate potential significant sources of Cr(VI), evaluate the capacity of the aquifer to naturally attenuate Cr(VI), and provide data sufficient to estimate distance and time Cr(VI) would revert to its trivalent form. BSA and field data showed that principal source of Cr(VI) was from the raw product, with secondary contribution from chromium in the native rock, and deterioration of stainless steel well screens. Natural attenuation of Cr(VI) to background concentrations was estimated at 2 to 3 years post injection. Monitoring of the Demonstration Plan area for the 2+ years has proved those predictions accurate and a Remedial Action Plan (RAP) recommending full-scale on- and off-site treatment of TCE with permanganate was submitted to the California Department of Toxic Substances Control (DTSC). Total cost of the work was $1.0MM+. • Remedial Excavation and ISCO Used to Facilitate Property Transfer, Sanmina, Inc., Irvine, California. Managed and implemented an aggressive remedial strategy for a former electronics manufacturing facility in Southern California. The site had TCE concentrations in groundwater suggestive of dense non-aqueous phase liquid (DNAPL) and required expedited soil and groundwater remediation, in lieu of ongoing 2-PHASE™ and dual- phase extraction (DPE) efforts, to accommodate its divesture and redevelopment. Groundwater was generally encountered at 15 feet below ground surface (bgs) and contained TCE concentrations in the source area as high as 77,000 µg/L. The project was successfully completed by installing a 90-well dewatering system, excavating 13,000 cubic yards (cy) of soils, and removing 3,200 cy of TCE impacted soil along the axis of a residual TCE DNAPL mass; total depth of the excavation was 32 feet bgs. ISCO using sodium and potassium permanganate was used to remediate residual TCE-impacted soil and groundwater outside the area of excavation. Following implementation of the aggressive remedial strategy, TCE concentrations in groundwater were reduced by one to three orders of magnitude, suggesting the DNAPL had been removed and/or destroyed. The Orange County Health Care Agency (OCHCA) provided soils closure and the Santa Ana Regional Water Quality Control Board provided groundwater closure for the site 16 months after completion of remediation. The site was sold and redeveloped. Total cost of excavation and ISCO application was approximately $1.4MM. • Assessment, Remediation and Closure of Former Industrial Facility for Residential Re-development, Former Boeing Plant, Los Angeles, California. Managed the assessment, remediation, and closure of a former asphalt batch plant and defense contractor facility on behalf of a residential developer. The work was performed simultaneously with planning and entitlement of the property, under the oversight of the County of Los Angeles Fire Department, Hazardous Materials Division. Unique challenges included the discovery of 15+ feet of buried asphalt debris and soils with elevated arsenic and chromium concentrations requiring off-site disposal. Developed site-specific cleanup thresholds for VOCs and heavy metals by preparing a limited human health risk assessment and incorporating Risk Based Screening Levels (RBSLs) developed by the San Francisco Regional Water Quality Control Board. The entire project was implemented in 15 months from initial assessment to site closure at a cost of $250,000. • Hydrocarbon Release Characterization and Remedial Investigation, Kinder Morgan Energy Partners, La Habra, California. 10/2018 5150 East Pacific Coast Highway, Suite 450 | Long Beach, CA 90804 4 of 4 Main: 310-879-4900 | Direct: 310-879-4920 E-mail: mescobar@rouxinc.com | Website: www.rouxinc.com Mauricio H. Escobar, P.G. Principal Geologist PROFESSIONAL PROFILE Designed, managed, and implemented a subsurface investigation with the primary focus of characterizing lateral and vertical distribution of hydrocarbon impacts to the groundwater and unsaturated zone. The release was related to a pipeline booster station flange rupture dating to the early 1980s. Fractured siltstone bedrock presented unique subsurface conditions and as a result, special consideration was given to drilling techniques and boring/well installations. The project involved 12 months of fieldwork for the installation of soil vapor probes, backhoe trenches, soil borings, and monitoring wells. Discovery of up to 15-feet of light non-aqueous phase liquids (LNAPL) resulted in amendments to the original work scope to provide for LNAPL removal and assessment of pneumatic and hydraulic properties of the soil/rock. A high vacuum DPE test was performed at selected wells to evaluate the feasibility of this technology for the removal of hydrocarbons. All work was conducted under the oversight of the Los Angeles Regional Water Quality Control Board in consideration of future residential development. Work was performed over a 2 year period at an approximate cost of $1.0MM. • Resource Conservation and Recovery Act (RCRA) Facility Investigation Work Plan for Bunker C Tank Farm Redevelopment, Long Beach, California. Managed the preparation of a RCRA Facility Investigation Work Plan for a former power plant tank farm facility in Long Beach, California. The site was being planned for redevelopment with a retail box store and restaurant uses. The RFI Work Plan was prepared as part of a Corrective Action Consent Agreement between the Client and the DTSC. The purpose of the RFI was to determine the nature and extent of releases at the site and to gather all the necessary data to support completion and implementation of a Corrective Measures Study (CMS). • Remedial Investigation of Former Transformer Washing Facility, General Electric and City of Los Angeles Redevelopment Agency, Los Angeles, California. Prepared, managed, and implemented a Remedial Investigation Work Plan for a former transformer washing facility under the oversight of the DTSC. The field investigation was intended to evaluate and delineate the nature and extent of residual VOC, PCB, and dioxin impacts at the Site, to support decisions regarding the need for, and extent of, future removal or remedial actions. The field program showed that shallow soils at the site were significantly impacted with PCBs and deep soils and groundwater were significantly impacted with TCE and tetrachloroethene (PCE).ISCO Demonstration Plan Using Permanganate, Riverside County, California. • Remedial Investigation and Remedial Action Plan for Former Small Arms Firing Range, City of Huntington Beach Community Development Office, Huntington Beach, California. Managed the preparation of a Remedial Investigation and RAP for the City of Huntington Beach in their effort to assess the extent of contamination and remedial options for a former public and police firing range. The project was performed under the oversight of the OCHCA. Relevant issues included soil berms and coal-tar treated wood posts impregnated with lead-shot, shallow landfill conditions (<5-feet), lack of a landfill cap, heavy hydrocarbon contamination, and landfill gas issues. The RAP included remedial options, costing, and an outline for implementation. Special consideration was given to the fact that the City intended to use the property for future Central Park recreational uses. The project was awarded on technical merit following a public bidding process that required the submittal of a formal proposal and interviews with City officials. Total cost of the project was $150,000, implemented over a 2 year period. 5/2019 5150 East Pacific Coast Highway, Suite 450 | Long Beach, CA 90804 1 of 1 Main: 310-879-4900 | Direct: 562-446-8697 E-mail: medwards@rouxinc.com | Website: www.rouxinc.com Mark A. Edwards Staff Assistant Geologist PROFESSIONAL PROFILE EXPERIENCE SUMMARY Joined Roux’s Long Beach office in September 2018. Previously worked as a Graduate Student Researcher at the University of California at Santa Barbara, culminating in an M.S. in Geochemistry in September 2018. CREDENTIALS M.S. Earth Science with concentration in Geochemistry, University of California at Santa Barbara, September 2018 B.S. Earth Science with concentration in Climate and Environment (with Honors), University of California at Santa Barbara, June 2014 Geologist in Training (GIT) Certificate, March 2019 OSHA HAWZOPER 40-hour training completed September 2018 (29 CFR 1910.120) AQMD Fugitive Dust Control Certificate issued January 2019 RELEVANT COURSEWORK Graduate: Mathematical Methods in Earth Science (Matlab), Soil Genesis, Isotope Geochemistry Undergraduate: Sedimentation and Stratigraphy, The Earth from Above (Remote Sensing), Introduction to Geological and Geophysical Data Analysis, Introduction to Geographic Information Systems, Introduction to Geochemistry, Geomaterials (Mineralogy), Geological Applications of GIS, Fundamentals of Structural Geology, Field Studies in Geological Methods, Earth’s Climate: Past and Present, Earth System: Ocean–Atmosphere ADDITIONAL EXPERIENCE Graduate research experience at UCSB includes geochemical analysis and lab work, specifically quantitative EPMA characterization, measurement of isotopic ratios using (LA)ICP-MS and TIMS, and wet chemistry in Class-1000 clean-lab environments. Performed a summer research internship at the University of Chicago in 2014 assisting with experimental photo-oxidation of reduced iron in an aqueous solution to simulate and study the origins of Banded Iron Formations. As an undergraduate student, completed a research project while at the University of Copenhagen investigating the redox-sensitive trace-element signatures of Neoproterozoic carbonates from the Wonoka Formation, Australia. ACADEMIC HONORS UCSB Earth Research Institute Summer Research Fellowship (June 2017) UCSB Department of Earth Science Graduate Opportunity Award (May 2017) UCSB Department of Earth Science Global Field Travel Fund Award (May 2017) UCSB Department of Earth Science Preston Cloud Memorial Award (May 2017) UCSB Department of Earth Science Outstanding Academic Achievement Award (June 2014) UCSB Department of Earth Science Outstanding Graduating Senior Award (June 2014) University of California Regent’s Scholar (September 2009 – June 2013) PUBLICATIONS AND PRESENTATIONS Edwards, M; Jackson, M; Kylander-Clark, A.; Harvey, J.; Hagen-Peter, G.; Seward, G.; Till, C.; Adams, J.; Cottle, J.; Hacker, B.; Spera, F (2019). Extreme enriched and heterogeneous 87Sr/86Sr ratios recorded in magmatic plagioclase from the Samoan hotspot. Earth and Planetary Science Letters. Edwards, M; Jackson, M; Kylander-Clark, A; Cottle, J; Harvey, J; Seward, G (2017). 87Sr/86Sr heterogeneity in OIB- hosted plagioclase. Interior of the Earth Gordon Research Conference, Mount Holyoke. ROUX KEY PROJECTS • Air Monitoring for Geotechnical Drilling at Superfund Site Field geologist responsible for performing worker breathing zone and perimeter air monitoring at a Superfund site in Santa Fe Springs, CA. • Phase II Investigation of Vacant Property Field geologist for Phase II investigation of vacant property in Norwalk, CA. Conducted soil, stockpile, and soil vapor sampling across the site, including an area with suspected illegal dumping impacts. • Fecal Coliform Groundwater Monitoring Responsible for overseeing quarterly groundwater monitoring and reporting for a site in Malibu, CA under RWQCB oversight. • Stormwater Sampling and Facility Inspections Perform ongoing monthly facility inspections and stormwater sampling at two cryogenic gas manufacturing plants in Los Angeles County, CA. Assist with uploading stormwater results to SMARTS and drafting annual reports.